RegulonDB RegulonDB 10.9: Gene Form
   

aspC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aspC ompF gloC MicF TSS_1229 TSS_1229 TSS_1228 TSS_1228 TSS_1227 TSS_1227 TSS_1226 (cluster) TSS_1226 (cluster) TSS_1225 (cluster) TSS_1225 (cluster) TSS_1224 TSS_1224 TSS_1223 TSS_1223 TSS_1222 TSS_1222 TSS_1221 TSS_1221 TSS_1220 TSS_1220 TSS_1219 (cluster) TSS_1219 (cluster) TSS_1218 TSS_1218 TSS_1217 TSS_1217 TSS_1216 TSS_1216 TSS_1215 (cluster) TSS_1215 (cluster) TSS_1214 TSS_1214 TSS_1213 TSS_1213 TSS_1212 TSS_1212 aspCp aspCp TSS_1211 TSS_1211 TSS_1210 TSS_1210 TSS_1209 TSS_1209 TSS_1208 TSS_1208 TSS_1207 (cluster) TSS_1207 (cluster) TSS_1206 TSS_1206

Gene      
Name: aspC    Texpresso search in the literature
Synonym(s): ECK0919, EG10096, b0928
Genome position(nucleotides): 984519 <-- 985709 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.23
External database links:  
ASAP:
ABE-0003150
CGSC:
990
ECHOBASE:
EB0094
ECOLIHUB:
aspC
OU-MICROARRAY:
b0928
STRING:
511145.b0928
COLOMBOS: aspC


Product      
Name: aspartate aminotransferase
Synonym(s): AspC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 43.573
Isoelectric point: 5.499
Motif(s):
 
Type Positions Sequence
133 -> 133 H
65 -> 65 Y
374 -> 374 R
280 -> 280 R
28 -> 392 KINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.5 - aspartate
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0004069 - L-aspartate:2-oxoglutarate aminotransferase activity
GO:0008483 - transaminase activity
GO:0004838 - L-tyrosine:2-oxoglutarate aminotransferase activity
GO:0030170 - pyridoxal phosphate binding
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006520 - cellular amino acid metabolic process
GO:0009058 - biosynthetic process
GO:0009094 - L-phenylalanine biosynthetic process
GO:0033585 - L-phenylalanine biosynthetic process from chorismate via phenylpyruvate
External database links:  
DIP:
DIP-9181N
ECOCYC:
ASPAMINOTRANS-MONOMER
ECOLIWIKI:
b0928
INTERPRO:
IPR000796
INTERPRO:
IPR004838
INTERPRO:
IPR015424
INTERPRO:
IPR015421
INTERPRO:
IPR015422
INTERPRO:
IPR004839
MODBASE:
P00509
PANTHER:
PTHR11879
PDB:
2D7Y
PDB:
2D7Z
PDB:
2Q7W
PDB:
2QA3
PDB:
2QB2
PDB:
2QB3
PDB:
2QBT
PDB:
3AAT
PDB:
3QN6
PDB:
3QPG
PDB:
3ZZJ
PDB:
3ZZK
PDB:
4A00
PDB:
4DBC
PDB:
4F5F
PDB:
4F5G
PDB:
4F5H
PDB:
4F5I
PDB:
4F5J
PDB:
4F5K
PDB:
4F5L
PDB:
4F5M
PDB:
5EAA
PDB:
5T4L
PDB:
5VWQ
PDB:
5VWR
PDB:
1AAM
PDB:
1AAW
PDB:
1AHE
PDB:
1AHF
PDB:
1AHG
PDB:
1AHX
PDB:
1AHY
PDB:
1AIA
PDB:
1AIB
PDB:
1AIC
PDB:
1AMQ
PDB:
1AMR
PDB:
1AMS
PDB:
1ARG
PDB:
1ARH
PDB:
1ARI
PDB:
1ARS
PDB:
1ART
PDB:
1ASA
PDB:
1ASB
PDB:
1ASC
PDB:
1ASD
PDB:
1ASE
PDB:
1ASF
PDB:
1ASG
PDB:
1ASL
PDB:
1ASM
PDB:
1ASN
PDB:
1B4X
PDB:
1BQA
PDB:
1BQD
PDB:
1C9C
PDB:
1CQ6
PDB:
1CQ7
PDB:
1CQ8
PDB:
1CZC
PDB:
1CZE
PDB:
1G4V
PDB:
1G4X
PDB:
1G7W
PDB:
1G7X
PDB:
1IX6
PDB:
1IX7
PDB:
1IX8
PDB:
1QIR
PDB:
1QIS
PDB:
1QIT
PDB:
1SPA
PDB:
1TOE
PDB:
1TOG
PDB:
1TOI
PDB:
1TOJ
PDB:
1TOK
PDB:
1X28
PDB:
1X29
PDB:
1X2A
PDB:
1YOO
PDB:
2AAT
PDB:
2D5Y
PDB:
2D61
PDB:
2D63
PDB:
2D64
PDB:
2D65
PDB:
2D66
PFAM:
PF00155
PRIDE:
P00509
PRINTS:
PR00799
PRODB:
PRO_000022172
PROSITE:
PS00105
REFSEQ:
NP_415448
SMR:
P00509
UNIPROT:
P00509


Operon      
Name: aspC         
Operon arrangement:
Transcription unit        Promoter
aspC


Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Repressed by: Fur, FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1206 983935 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1207 (cluster) 984970 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1208 985039 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1209 985236 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1210 985360 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1211 985652 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1212 985744 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1213 985982 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1214 985984 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1215 (cluster) 985988 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1216 986008 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1217 986010 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1218 986077 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1219 (cluster) 986081 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1220 986084 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1221 986119 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1222 986124 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1223 986314 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1224 986647 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1225 (cluster) 986768 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1226 (cluster) 986786 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1227 986788 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1228 986897 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1229 986969 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB