RegulonDB RegulonDB 10.9: Gene Form
   

atpE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

atpB atpF atpE TSS_4340 (cluster) TSS_4340 (cluster) TSS_4339 (cluster) TSS_4339 (cluster) TSS_4338 (cluster) TSS_4338 (cluster) TSS_4337 (cluster) TSS_4337 (cluster) TSS_4336 TSS_4336 TSS_4335 TSS_4335 TSS_4334 TSS_4334 TSS_4333 TSS_4333 TSS_4332 (cluster) TSS_4332 (cluster) TSS_4331 TSS_4331 TSS_4330 (cluster) TSS_4330 (cluster) TSS_4329 TSS_4329 TSS_4328 TSS_4328 TSS_4327 TSS_4327 TSS_4326 TSS_4326 TSS_4325 TSS_4325 TSS_4324 TSS_4324 TSS_4323 (cluster) TSS_4323 (cluster)

Gene      
Name: atpE    Texpresso search in the literature
Synonym(s): ECK3730, EG10102, b3737, papH, uncE
Genome position(nucleotides): 3920950 <-- 3921189 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.17
External database links:  
ASAP:
ABE-0012220
CGSC:
29
ECHOBASE:
EB0100
ECOLIHUB:
atpE
OU-MICROARRAY:
b3737
STRING:
511145.b3737
COLOMBOS: atpE


Product      
Name: ATP synthase Fo complex subunit c
Synonym(s): ATP synthase Fo complex - subunit c, AtpE, Fo-c, PapH, UncE, dicyclohexylcarbodiimide-binding protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 8.256
Isoelectric point: 4.228
Motif(s):
 
Type Positions Sequence
31 -> 31 L
23 -> 23 G
11 -> 71 MAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVDAIPMIAVGLG
53 -> 73 FFIVMGLVDAIPMIAVGLGLY
76 -> 76 F

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.8 - ATP proton motive force interconversion
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.2 - The H+- or Na+-translocating F-type, V-type and A-type ATPase (F-ATPase) Su
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0033177 - proton-transporting two-sector ATPase complex, proton-transporting domain
GO:0045263 - proton-transporting ATP synthase complex, coupling factor F(o)
molecular_function GO:0015078 - proton transmembrane transporter activity
GO:0046933 - proton-transporting ATP synthase activity, rotational mechanism
GO:0046961 - proton-transporting ATPase activity, rotational mechanism
GO:0008289 - lipid binding
biological_process GO:0006754 - ATP biosynthetic process
GO:0006811 - ion transport
GO:0015986 - ATP synthesis coupled proton transport
GO:1902600 - proton transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Nishikawa H., et al., 2017
[2] Steed PR., et al., 2014
External database links:  
DIP:
DIP-2198N
ECOCYC:
ATPE-MONOMER
ECOLIWIKI:
b3737
INTERPRO:
IPR002379
INTERPRO:
IPR038662
INTERPRO:
IPR005953
INTERPRO:
IPR020537
INTERPRO:
IPR035921
INTERPRO:
IPR000454
MINT:
P68699
MODBASE:
P68699
PANTHER:
PTHR10031
PDB:
5T4Q
PDB:
5T4P
PDB:
5T4O
PDB:
4UTQ
PDB:
1QO1
PDB:
1L6T
PDB:
1J7F
PDB:
1IJP
PDB:
1C99
PDB:
1C17
PDB:
1C0V
PDB:
1ATY
PDB:
1A91
PFAM:
PF00137
PRIDE:
P68699
PRINTS:
PR00124
PRODB:
PRO_000022190
PROSITE:
PS00605
REFSEQ:
NP_418193
SMR:
P68699
UNIPROT:
P68699


Operon      
Name: atpIBEFHAGDC         
Operon arrangement:
Transcription unit        Promoter
atpBEFHAGDC
atpBEFHAGDC
atpIBEFHAGDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4323 (cluster) 3920436 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4324 3920475 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4325 3920485 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4326 3920588 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4327 3920598 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4328 3920997 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4329 3921003 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4330 (cluster) 3921379 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4331 3921382 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4332 (cluster) 3921385 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4333 3921390 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4334 3921401 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4335 3921709 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4336 3921775 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4337 (cluster) 3921812 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4338 (cluster) 3921818 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4339 (cluster) 3921823 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4340 (cluster) 3921829 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Nishikawa H., Sasaki M., Nishiyama KI., 2017, Membrane insertion of F0 c subunit of F0 F1 ATPase depends on glycolipozyme MPIase and is stimulated by YidC., Biochem Biophys Res Commun 487(2):477-482

 [2] Steed PR., Kraft KA., Fillingame RH., 2014, Interacting cytoplasmic loops of subunits a and c of Escherichia coli F1F0 ATP synthase gate H+ transport to the cytoplasm., Proc Natl Acad Sci U S A 111(47):16730-5

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB