RegulonDB RegulonDB 10.9: Gene Form
   

atpH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

atpA atpH atpF TSS_4327 TSS_4327 TSS_4326 TSS_4326 TSS_4325 TSS_4325 TSS_4324 TSS_4324 TSS_4323 (cluster) TSS_4323 (cluster) TSS_4322 TSS_4322 TSS_4321 (cluster) TSS_4321 (cluster) TSS_4320 TSS_4320 TSS_4319 TSS_4319 TSS_4318 TSS_4318 TSS_4317 TSS_4317 TSS_4316 TSS_4316 TSS_4315 TSS_4315 TSS_4314 TSS_4314 TSS_4313 TSS_4313 TSS_4312 TSS_4312 TSS_4311 TSS_4311 TSS_4310 (cluster) TSS_4310 (cluster) TSS_4309 TSS_4309 TSS_4308 TSS_4308

Gene      
Name: atpH    Texpresso search in the literature
Synonym(s): ECK3728, EG10105, b3735, papE, uncH
Genome position(nucleotides): 3919870 <-- 3920403 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.87
External database links:  
ASAP:
ABE-0012215
CGSC:
26
ECHOBASE:
EB0103
ECOLIHUB:
atpH
OU-MICROARRAY:
b3735
STRING:
511145.b3735
COLOMBOS: atpH


Product      
Name: ATP synthase F1 complex subunit δ
Synonym(s): ATP synthase F1 complex - delta subunit, AtpH, PapE, UncH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 19.332
Isoelectric point: 4.66
Motif(s):
 
Type Positions Sequence
7 -> 174 VARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGALAPETLAESFIAVCGEQLDENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKLNCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLADV
82 -> 82 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.8 - ATP proton motive force interconversion
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.2 - The H+- or Na+-translocating F-type, V-type and A-type ATPase (F-ATPase) Su
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0045261 - proton-transporting ATP synthase complex, catalytic core F(1)
molecular_function GO:0046933 - proton-transporting ATP synthase activity, rotational mechanism
GO:0046961 - proton-transporting ATPase activity, rotational mechanism
biological_process GO:0006754 - ATP biosynthetic process
GO:0006811 - ion transport
GO:0015986 - ATP synthesis coupled proton transport
Note(s): Note(s): ...[more].
Reference(s): [1] Hilbers F., et al., 2013
External database links:  
DIP:
DIP-47921N
ECOCYC:
ATPH-MONOMER
ECOLIWIKI:
b3735
INTERPRO:
IPR020781
INTERPRO:
IPR000711
INTERPRO:
IPR026015
MODBASE:
P0ABA4
PANTHER:
PTHR11910
PDB:
5T4Q
PDB:
5T4P
PDB:
5T4O
PDB:
2A7U
PDB:
1ABV
PFAM:
PF00213
PRIDE:
P0ABA4
PRINTS:
PR00125
PRODB:
PRO_000022193
PROSITE:
PS00389
REFSEQ:
NP_418191
SMR:
P0ABA4
UNIPROT:
P0ABA4


Operon      
Name: atpIBEFHAGDC         
Operon arrangement:
Transcription unit        Promoter
atpBEFHAGDC
atpBEFHAGDC
atpIBEFHAGDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4308 3918597 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4309 3918988 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4310 (cluster) 3919083 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4311 3919085 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4312 3919114 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4313 3919282 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4314 3919287 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4315 3919409 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4316 3919427 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4317 3919430 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4318 3919444 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4319 3919510 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4320 3919515 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4321 (cluster) 3919763 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4322 3919977 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4323 (cluster) 3920436 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4324 3920475 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4325 3920485 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4326 3920588 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4327 3920598 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hilbers F., Eggers R., Pradela K., Friedrich K., Herkenhoff-Hesselmann B., Becker E., Deckers-Hebestreit G., 2013, Subunit δ is the key player for assembly of the H(+)-translocating unit of Escherichia coli F(O)F1 ATP synthase., J Biol Chem 288(36):25880-94

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB