RegulonDB RegulonDB 10.9: Gene Form
   

avtA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

malS avtA ysaA avtAp avtAp

Gene      
Name: avtA    Texpresso search in the literature
Synonym(s): ECK3561, EG10107, b3572
Genome position(nucleotides): 3739705 --> 3740958 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.15
External database links:  
ASAP:
ABE-0011671
CGSC:
971
ECHOBASE:
EB0105
ECOLIHUB:
avtA
OU-MICROARRAY:
b3572
STRING:
511145.b3572
COLOMBOS: avtA


Product      
Name: valine—pyruvate aminotransferase
Synonym(s): AvtA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 46.711
Isoelectric point: 5.83
Motif(s):
 
Type Positions Sequence
165 -> 391 FKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDEELLKLDALANQHGIPLVIDNAYGVPFPGIIFSEARPLWNPNIVLCMSLSKLGLPGSRCGIIIANEKIITAITNMNGIISLAPGGIGPAMMCEMIKRNDLLRLSETVIKPFYYQRVQETIAIIRRYLPENRCLIHKPEGAIFLWLWFKDLPITTKQLYQRLKARGVLMVPGHNFFPGLDKPWPHTHQCMRMNY
208 -> 208 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.17 - alanine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0008483 - transaminase activity
GO:0030170 - pyridoxal phosphate binding
GO:0009042 - valine-pyruvate transaminase activity
biological_process GO:0009058 - biosynthetic process
GO:0009099 - valine biosynthetic process
GO:0042852 - L-alanine biosynthetic process
GO:0030632 - D-alanine biosynthetic process
GO:1901605 - alpha-amino acid metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Berg CM., et al., 1988
[2] Cho BK., et al., 2003
[3] Holtzclaw WD., et al., 1977
[4] Liu L., et al., 1987
[5] Lorenz E., et al., 2013
[6] Vartak NB., et al., 1991
[7] Wang MD., et al., 1987
External database links:  
ECOCYC:
VALINE-PYRUVATE-AMINOTRANSFER-MONOMER
ECOLIWIKI:
b3572
INTERPRO:
IPR004839
INTERPRO:
IPR015421
INTERPRO:
IPR015424
MODBASE:
P09053
PFAM:
PF00155
PRIDE:
P09053
REFSEQ:
YP_026231
SMR:
P09053
UNIPROT:
P09053


Operon      
Name: avtA         
Operon arrangement:
Transcription unit        Promoter
avtA


Transcriptional Regulation      
Display Regulation             
Repressed by: Lrp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Berg CM., Wang MD., Vartak NB., Liu L., 1988, Acquisition of new metabolic capabilities: multicopy suppression by cloned transaminase genes in Escherichia coli K-12., Gene 65(2):195-202

 [2] Cho BK., Cho HJ., Park SH., Yun H., Kim BG., 2003, Simultaneous synthesis of enantiomerically pure (S)-amino acids and (R)-amines using coupled transaminase reactions., Biotechnol Bioeng 81(7):783-9

 [3] Holtzclaw WD., Chapman LF., 1977, A new assay for transaminase C., Anal Biochem 83(1):162-7

 [4] Liu L., Whalen W., Das A., Berg CM., 1987, Rapid sequencing of cloned DNA using a transposon for bidirectional priming: sequence of the Escherichia coli K-12 avtA gene., Nucleic Acids Res 15(22):9461-9

 [5] Lorenz E., Klatte S., Wendisch VF., 2013, Reductive amination by recombinant Escherichia coli: whole cell biotransformation of 2-keto-3-methylvalerate to L-isoleucine., J Biotechnol 168(3):289-94

 [6] Vartak NB., Liu L., Wang BM., Berg CM., 1991, A functional leuABCD operon is required for leucine synthesis by the tyrosine-repressible transaminase in Escherichia coli K-12., J Bacteriol 173(12):3864-71

 [7] Wang MD., Buckley L., Berg CM., 1987, Cloning of genes that suppress an Escherichia coli K-12 alanine auxotroph when present in multicopy plasmids., J Bacteriol 169(12):5610-4


RegulonDB