RegulonDB RegulonDB 10.9: Gene Form
   

bioF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bioA bioF bioB bioC bioD BirA terminator bioBp bioBp bioAp bioAp TSS_941 TSS_941 ybhBp2 ybhBp2

Gene      
Name: bioF    Texpresso search in the literature
Synonym(s): ECK0765, EG10121, b0776
Genome position(nucleotides): 810381 --> 811535 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.01
External database links:  
ASAP:
ABE-0002646
CGSC:
955
ECHOBASE:
EB0119
ECOLIHUB:
bioF
OU-MICROARRAY:
b0776
STRING:
511145.b0776
COLOMBOS: bioF


Product      
Name: 8-amino-7-oxononanoate synthase
Synonym(s): BioF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.594
Isoelectric point: 7.146
Motif(s):
 
Type Positions Sequence
188 -> 189 AE
2 -> 384 SWQEKINAALDARRAADALRRRYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFGIGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKVKPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAGTARLRLTLTAAHEMQDIDRLLEVLHGNG
40 -> 380 QYLNFSSNDYLGLSHHPQIIRAWQQGAEQFGIGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKVKPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAGTARLRLTLTAAHEMQDIDRLLEVL
108 -> 109 GF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.1 - biotin
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0008710 - 8-amino-7-oxononanoate synthase activity
GO:0030170 - pyridoxal phosphate binding
biological_process GO:0009058 - biosynthetic process
GO:0009102 - biotin biosynthetic process
External database links:  
DIP:
DIP-6870N
ECOCYC:
7KAPSYN-MONOMER
ECOLIWIKI:
b0776
INTERPRO:
IPR015422
INTERPRO:
IPR004839
INTERPRO:
IPR015421
INTERPRO:
IPR022834
INTERPRO:
IPR001917
INTERPRO:
IPR004723
INTERPRO:
IPR015424
MODBASE:
P12998
PDB:
2G6W
PDB:
1DJE
PDB:
1DJ9
PDB:
1BS0
PFAM:
PF00155
PRIDE:
P12998
PRODB:
PRO_000022225
PROSITE:
PS00599
REFSEQ:
NP_415297
SMR:
P12998
UNIPROT:
P12998


Operon      
Name: bioBFCD         
Operon arrangement:
Transcription unit        Promoter
bioBFCD


Transcriptional Regulation      
Display Regulation             
Repressed by: BirA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybhBp2 808035 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_941 809290 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB