RegulonDB RegulonDB 10.9: Gene Form
   

btuE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

btuC btuD btuE nlpC TSS_2002 TSS_2002 TSS_2001 TSS_2001 btuEp2 btuEp2 btuEp btuEp btuDp btuDp nlpCp3 nlpCp3 nlpCp5 nlpCp5 TSS_1999 TSS_1999

Gene      
Name: btuE    Texpresso search in the literature
Synonym(s): ECK1708, EG10129, b1710
Genome position(nucleotides): 1793558 <-- 1794109 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.46
External database links:  
ASAP:
ABE-0005709
CGSC:
18496
ECHOBASE:
EB0127
ECOLIHUB:
btuE
MIM:
614266
OU-MICROARRAY:
b1710
STRING:
511145.b1710
COLOMBOS: btuE


Product      
Name: thioredoxin/glutathione peroxidase
Synonym(s): BtuE
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 20.47
Isoelectric point: 4.533
Motif(s):
 
Type Positions Sequence
6 -> 111 LTTVVKDIDGEVTTLEKFAGNVLLIVNVASKCGLTPQYEQLENIQKAWVDRGFMVLGFPCNQFLEQEPGSDEEIKTYCTTTWGVTFPMFSKIEVNGEGRHPLYQKL

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0042597 - periplasmic space
molecular_function GO:0016491 - oxidoreductase activity
GO:0004601 - peroxidase activity
GO:0004602 - glutathione peroxidase activity
GO:0008379 - thioredoxin peroxidase activity
GO:0051920 - peroxiredoxin activity
biological_process GO:0006979 - response to oxidative stress
GO:0055114 - oxidation-reduction process
GO:0033194 - response to hydroperoxide
GO:0098869 - cellular oxidant detoxification
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
BTUE-MONOMER
ECOLIWIKI:
b1710
INTERPRO:
IPR036249
INTERPRO:
IPR033674
INTERPRO:
IPR029760
INTERPRO:
IPR000889
INTERPRO:
IPR029759
MODBASE:
P06610
PANTHER:
PTHR11592
PFAM:
PF00255
PRIDE:
P06610
PRINTS:
PR01011
PRODB:
PRO_000022237
PROSITE:
PS51355
PROSITE:
PS00763
PROSITE:
PS00460
REFSEQ:
NP_416225
SMR:
P06610
SWISSMODEL:
P06610
UNIPROT:
P06610


Operon      
Name: btuCED         
Operon arrangement:
Transcription unit        Promoter
btuD
btuE
btuE
btuCED


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1999 1792637 reverse nd [RS-EPT-CBR] [1]
  promoter nlpCp5 1792760 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [1], [2]
  promoter nlpCp3 1792827 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2001 1794137 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2002 1794143 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB