RegulonDB RegulonDB 11.0: Gene Form
   

carA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

carB carA dapB ArgR ArgR Fis PepA Fis PurR Fis PepA RutR IHF TSS_78 TSS_78 TSS_77 TSS_77 carBp carBp carAp2 carAp2 carAp1 carAp1

Gene      
Name: carA    Texpresso search in the literature
Synonym(s): ECK0033, EG10134, arg, b0032, pyrA
Genome position(nucleotides): 29651 --> 30799
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.35
External database links:  
ASAP:
ABE-0000118
CGSC:
936
ECHOBASE:
EB0132
ECOLIHUB:
carA
NCBI-GENE:
949025
OU-MICROARRAY:
b0032
STRING:
511145.b0032
COLOMBOS: carA


Product      
Name: carbamoyl-phosphate synthetase small subunit
Synonym(s): Arg, CarA, PyrA, carbamoyl phosphate synthetase, alpha; chain, carbamoyl-phosphate synthetase subunit alpha;
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.431
Isoelectric point: 6.338
Motif(s):
 
Type Positions Sequence Comment
1 -> 189 MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKKEDE UniProt: CPSase; Sequence Annotation Type: region of interest.
7 -> 132 LVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCI
193 -> 380 HVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRKT UniProt: Glutamine amidotransferase type-1.
197 -> 372 YDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.3 - arginine
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.2 - pyrimidine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005951 - carbamoyl-phosphate synthase complex
molecular_function GO:0005515 - protein binding
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004088 - carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
GO:0046982 - protein heterodimerization activity
biological_process GO:0006221 - pyrimidine nucleotide biosynthetic process
GO:0006526 - arginine biosynthetic process
GO:0006541 - glutamine metabolic process
GO:0006807 - nitrogen compound metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0006207 - 'de novo' pyrimidine nucleobase biosynthetic process
GO:0019856 - pyrimidine nucleobase biosynthetic process
GO:0044205 - 'de novo' UMP biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Blank D., et al., 2014
[2] Crabeel M., et al., 1978
[3] Piette J., et al., 1984
External database links:  
ALPHAFOLD:
P0A6F1
DIP:
DIP-35412N
ECOCYC:
CARBPSYN-SMALL
ECOLIWIKI:
b0032
INTERPRO:
IPR002474
INTERPRO:
IPR006274
INTERPRO:
IPR029062
INTERPRO:
IPR036480
INTERPRO:
IPR035686
INTERPRO:
IPR017926
MODBASE:
P0A6F1
PDB:
1C3O
PDB:
1CE8
PDB:
1CS0
PDB:
1JDB
PDB:
1KEE
PDB:
1M6V
PDB:
1A9X
PDB:
1T36
PDB:
1BXR
PDB:
1C30
PFAM:
PF00988
PFAM:
PF00117
PRIDE:
P0A6F1
PRODB:
PRO_000022247
PROSITE:
PS51273
REFSEQ:
NP_414573
SMART:
SM01097
SMR:
P0A6F1
UNIPROT:
P0A6F1


Operon      
Name: carAB         
Operon arrangement:
Transcription unit        Promoter
carAB
carAB
carB


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, Fis, RutR
Repressed by: PurR, IHF, ArgR, PepA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_77 31596 forward nd [RS-EPT-CBR] [4]
  promoter TSS_78 31603 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Blank D., Wolf L., Ackermann M., Silander OK., 2014, The predictability of molecular evolution during functional innovation., Proc Natl Acad Sci U S A 111(8):3044-9

 [2] Crabeel M., Charlier D., Weyens G., Feller A., Glansdorff N., Pierard A., 1978, Repressible expression of an Escherichia coli carA gene inserted into a colicinogenic factor [proceedings]., Arch Int Physiol Biochim 86(4):912-3

 [3] Piette J., Nyunoya H., Lusty CJ., Cunin R., Weyens G., Crabeel M., Charlier D., Glansdorff N., Pierard A., 1984, DNA sequence of the carA gene and the control region of carAB: tandem promoters, respectively controlled by arginine and the pyrimidines, regulate the synthesis of carbamoyl-phosphate synthetase in Escherichia coli K-12., Proc Natl Acad Sci U S A 81(13):4134-8

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB