RegulonDB RegulonDB 10.9: Gene Form
   

cca gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cca bacA ygiM TSS_3365 TSS_3365

Gene      
Name: cca    Texpresso search in the literature
Synonym(s): ECK3046, EG10136, b3056
Genome position(nucleotides): 3201891 --> 3203129 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.26
External database links:  
ASAP:
ABE-0010031
CGSC:
933
ECHOBASE:
EB0134
ECOLIHUB:
cca
OU-MICROARRAY:
b3056
STRING:
511145.b3056
COLOMBOS: cca


Product      
Name: fused CCA tRNA nucleotidyltransferase/phosphohydrolase
Synonym(s): CCA-adding enzyme, Cca, fused CCA tRNA nucleotidyltransferase / 2',3'-cyclic phosphodiesterase / 2' nucleotidase and phosphatase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 46.467
Isoelectric point: 6.634
Motif(s):
 
Type Positions Sequence
255 -> 255 H
256 -> 256 D
70 -> 70 G
229 -> 328 GIHTLMTLSMAAMLSPQVDVRFATLCHDLGKGLTPPELWPRHHGHGPAGVKLVEQLCQRLRVPNEIRDLARLVAEFHDLIHTFPMLNPKTIVKLFDSIDA
3 -> 122 IYLVGGAVRDALLGLPVKDRDWVVVGSTPQEMLDAGYQQVGRDFPVFLHPQTHEEYALARTERKSGSGYTGFTCYAAPDVTLEDDLKRRDLTINALAQDDNGEIIDPYNGLGDLQNRLLR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016779 - nucleotidyltransferase activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0003723 - RNA binding
GO:0004112 - cyclic-nucleotide phosphodiesterase activity
GO:0016791 - phosphatase activity
GO:0000049 - tRNA binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004810 - tRNA adenylyltransferase activity
GO:0016437 - tRNA cytidylyltransferase activity
GO:0000287 - magnesium ion binding
GO:0052927 - CTP:tRNA cytidylyltransferase activity
GO:0052928 - CTP:3'-cytidine-tRNA cytidylyltransferase activity
GO:0052929 - ATP:3'-cytidine-cytidine-tRNA adenylyltransferase activity
biological_process GO:0008152 - metabolic process
GO:0016311 - dephosphorylation
GO:0006396 - RNA processing
GO:0008033 - tRNA processing
GO:0001680 - tRNA 3'-terminal CCA addition
GO:0042245 - RNA repair
Note(s): Note(s): ...[more].
Reference(s): [1] Buneva VN., et al., 1982
[2] Cudny H., et al., 1986
[3] Deutscher MP. 1990
[4] Deutscher MP. 1974
[5] Deutscher MP., et al., 1975
[6] Deutscher MP., et al., 1974
[7] Deutscher MP., et al., 1985
[8] Foulds J., et al., 1974
[9] Gamper H., et al., 2018
[10] Hegg LA., et al., 1990
[11] Honda H. 1969
[12] Li Z., et al., 1996
[13] Li Z., et al., 1997
[14] Morse JW., et al., 1976
[15] Prochiantz A., et al., 1975
[16] Schmidt FJ. 1975
[17] Seidman JG., et al., 1975
[18] Shi PY., et al., 1998
External database links:  
DIP:
DIP-9250N
ECOCYC:
EG10136-MONOMER
ECOLIWIKI:
b3056
INTERPRO:
IPR012006
INTERPRO:
IPR043519
INTERPRO:
IPR032828
INTERPRO:
IPR006674
INTERPRO:
IPR003607
INTERPRO:
IPR002646
MODBASE:
P06961
PFAM:
PF12627
PFAM:
PF01966
PFAM:
PF01743
PRIDE:
P06961
PRODB:
PRO_000022254
PROSITE:
PS51831
REFSEQ:
NP_417528
SMR:
P06961
UNIPROT:
P06961


Operon      
Name: ygiM-cca         
Operon arrangement:
Transcription unit        Promoter
htrG-cca
ygiM


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3365 3201334 forward nd [RS-EPT-CBR] [19]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Buneva VN., Gorshkova II., Knorre DG., Pacha IO., 1982, [Modification of the catalytic center of Escherichia coli ATP(CTP): tRNA-nucleotidyltransferase by adenosine and cytidine triphosphate derivatives with a reactive group in the triphosphate fragment]., Dokl Akad Nauk SSSR 267(6):1492-5

 [2] Cudny H., Lupski JR., Godson GN., Deutscher MP., 1986, Cloning, sequencing, and species relatedness of the Escherichia coli cca gene encoding the enzyme tRNA nucleotidyltransferase., J Biol Chem 261(14):6444-9

 [3] Deutscher MP., 1990, Transfer RNA nucleotidyltransferase., Methods Enzymol 181:434-9

 [4] Deutscher MP., 1974, Preparation of cells permeable to macromolecules by treatment with toluene: studies of transfer ribonucleic acid nucleotidyltransferase., J Bacteriol 118(2):633-9

 [5] Deutscher MP., Foulds J., Morse JW., Hilderman RH., 1975, Synthesis of the CCA terminus of transfer RNA., Brookhaven Symp Biol (26):124-37

 [6] Deutscher MP., Hilderman RH., 1974, Isolation and partial characterization of Escherichia coli mutants with low levels of transfer ribonucleic acid nucleotidyltransferase., J Bacteriol 118(2):621-7

 [7] Deutscher MP., Marlor CW., Zaniewski R., 1985, RNase T is responsible for the end-turnover of tRNA in Escherichia coli., Proc Natl Acad Sci U S A 82(19):6427-30

 [8] Foulds J., Hilderman RH., Deutscher MP., 1974, Mapping of the locus for Escherichia coli transfer ribonucleic acid nucleotidyltransferase., J Bacteriol 118(2):628-32

 [9] Gamper H., Hou YM., 2018, tRNA 3'-amino-tailing for stable amino acid attachment., RNA 24(12):1878-1885

 [10] Hegg LA., Thurlow DL., 1990, Cytidines in tRNAs that are required intact by ATP/CTP:tRNA nucleotidyltransferases from Escherichia coli and Saccharomyces cerevisiae., Nucleic Acids Res 18(20):5975-9

 [11] Honda H., 1969, Formation of the complex between CCA-enzyme and transfer RNA., Biochim Biophys Acta 195(2):587-9

 [12] Li Z., Gillis KA., Hegg LA., Zhang J., Thurlow DL., 1996, Effects of nucleotide substitutions within the T-loop of precursor tRNAs on interaction with ATP/CTP:tRNA nucleotidyltransferases from Escherichia coli and yeast., Biochem J 314 ( Pt 1):49-53

 [13] Li Z., Sun Y., Thurlow DL., 1997, RNA minihelices as model substrates for ATP/CTP:tRNA nucleotidyltransferase., Biochem J 327 ( Pt 3):847-51

 [14] Morse JW., Deutscher MP., 1976, A physiological role for tRNA nucleotidyltransferase during bacteriophage infection., Biochem Biophys Res Commun 73(4):953-9

 [15] Prochiantz A., Benicourt C., Carre D., Haenni AL., 1975, tRNA nucleotidyltransferase-catalyzed incorporation of CMP and AMP into RNA-bacteriophage genome fragments., Eur J Biochem 52(1):17-23

 [16] Schmidt FJ., 1975, A novel function of Escherichia coli transfer RNA nucleotidyltransferase. Biosynthesis of the C-C-A sequence in a phage T4 transfer RNA precursor., J Biol Chem 250(21):8399-403

 [17] Seidman JG., McClain WH., 1975, Three steps in conversion of large precursor RNA into serine and proline transfer RNAs., Proc Natl Acad Sci U S A 72(4):1491-5

 [18] Shi PY., Weiner AM., Maizels N., 1998, A top-half tDNA minihelix is a good substrate for the eubacterial CCA-adding enzyme., RNA 4(3):276-84

 [19] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB