RegulonDB RegulonDB 10.8: Gene Form
   

cdd gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cdd sanA yohK yohJ NsrR CRP CytR CytR CRP CRP terminator anti-terminator anti-anti-terminator sanAp3 sanAp3 cddp cddp

Gene      
Name: cdd    Texpresso search in the literature
Synonym(s): ECK2136, EG10137, b2143
Genome position(nucleotides): 2231844 --> 2232728 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.69
External database links:  
ASAP:
ABE-0007086
CGSC:
932
ECHOBASE:
EB0135
OU-MICROARRAY:
b2143
PortEco:
cdd
STRING:
511145.b2143
COLOMBOS: cdd


Product      
Name: cytidine/deoxycytidine deaminase
Synonym(s): Cdd
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.54
Isoelectric point: 5.525
Motif(s):
 
Type Positions Sequence
48 -> 168 DEDALAFALLPLAAACARTPLSNFNVGAIARGVSGTWYFGANMEFIGATMQQTVHAEQSAISHAWLSGEKALAAITVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHALRDYLPDAFGPK
60 -> 139 AAACARTPLSNFNVGAIARGVSGTWYFGANMEFIGATMQQTVHAEQSAISHAWLSGEKALAAITVNYTPCGHCRQFMNEL
157 -> 276 LRDYLPDAFGPKDLEIKTLLMDEQDHGYALTGDALSQAAIAAANRSHMPYSKSPSGVALECKDGRIFSGSYAENAAFNPTLPPLQGALILLNLKGYDYPDIQRAVLAEKADAPLIQWDAT
4 -> 4 R
89 -> 91 NME

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0004126 - cytidine deaminase activity
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
GO:0001884 - pyrimidine nucleoside binding
GO:0047844 - deoxycytidine deaminase activity
biological_process GO:0015949 - nucleobase-containing small molecule interconversion
GO:0009972 - cytidine deamination
GO:0006217 - deoxycytidine catabolic process
Reference(s): [1] Josephsen J., et al., 1983
[2] Middendorf A., et al., 1984
External database links:  
DIP:
DIP-36169N
ECOCYC:
CYTIDEAM-MONOMER
ECOLIWIKI:
b2143
INTERPRO:
IPR020797
INTERPRO:
IPR016193
INTERPRO:
IPR016192
INTERPRO:
IPR013171
INTERPRO:
IPR006263
INTERPRO:
IPR002125
MINT:
MINT-1283574
MODBASE:
P0ABF6
PANTHER:
PTHR11644:SF12
PDB:
1CTU
PDB:
1CTT
PDB:
1AF2
PDB:
1ALN
PFAM:
PF08211
PFAM:
PF00383
PRIDE:
P0ABF6
PROSITE:
PS00903
PROSITE:
PS51747
REFSEQ:
NP_416648
SMR:
P0ABF6
UNIPROT:
P0ABF6


Operon      
Name: cdd         
Operon arrangement:
Transcription unit        Promoter
cdd


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: CRP, NsrR, CytR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter sanAp3 2232684 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Josephsen J., Hammer-Jespersen K., Hansen TD., 1983, Mapping of the gene for cytidine deaminase (cdd) in Escherichia coli K-12., J Bacteriol 154(1):72-5

 [2] Middendorf A., Schweizer H., Vreemann J., Boos W., 1984, Mapping of markers in the gyrA-his region of Escherichia coli., Mol Gen Genet 197(1):175-81

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB