RegulonDB RegulonDB 11.0: Gene Form
   

chbR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

chbF chbR chbA TSS_2046 TSS_2046 chbGp5 chbGp5 chbGp4 chbGp4

Gene      
Name: chbR    Texpresso search in the literature
Synonym(s): ECK1733, EG10143, b1735, celD
Genome position(nucleotides): 1818605 <-- 1819447
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.52
External database links:  
ASAP:
ABE-0005790
CGSC:
18481
ECHOBASE:
EB0141
ECOLIHUB:
chbR
OU-MICROARRAY:
b1735
STRING:
511145.b1735
COLOMBOS: chbR


Product      
Name: ChbR
Synonym(s): CelD
Sequence: Get amino acid sequence Fasta Format
Regulator Family: AraC/XylS
Cellular location: cytosol
Molecular weight: 32.968
Isoelectric point: 8.726
Motif(s):
 
Type Positions Sequence Comment
29 -> 81 IYNKTESISGLHQHDYYEFTLVLTGRYFQEINGKRVLLERGDFVFIPLGSHHQ
168 -> 274 DDVPQWLKSTVEKMHDKEQFSESALENMVALSAKSQEYLTRATQRYYGKTPMQIINEIRINFAKKQLEMTNYSVTDIAFEAGYSSPSLFIKTFKKLTSFTPKSYRKK UniProt: HTH araC/xylS-type.
193 -> 214 ENMVALSAKSQEYLTRATQRYY UniProt: H-T-H motif.
200 -> 273 AKSQEYLTRATQRYYGKTPMQIINEIRINFAKKQLEMTNYSVTDIAFEAGYSSPSLFIKTFKKLTSFTPKSYRK
241 -> 264 VTDIAFEAGYSSPSLFIKTFKKLT UniProt: H-T-H motif.

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
GO:0042803 - protein homodimerization activity
GO:0001046 - core promoter sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
External database links:  
ALPHAFOLD:
P17410
ECOCYC:
EG10143-MONOMER
ECOLIWIKI:
b1735
INTERPRO:
IPR011051
INTERPRO:
IPR020449
INTERPRO:
IPR014710
INTERPRO:
IPR018060
INTERPRO:
IPR013096
INTERPRO:
IPR009057
INTERPRO:
IPR018062
MODBASE:
P17410
PFAM:
PF07883
PFAM:
PF12833
PRIDE:
P17410
PRINTS:
PR00032
PRODB:
PRO_000022276
PROSITE:
PS00041
PROSITE:
PS01124
REFSEQ:
NP_416249
SMART:
SM00342
SMR:
P17410
UNIPROT:
P17410


Operon      
Name: chbBCARFG         
Operon arrangement:
Transcription unit        Promoter
chbBCARFG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, ChbR
Repressed by: ChbR, NagC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter chbGp4 1817242 reverse nd [ICWHO] [1]
  promoter chbGp5 1817312 reverse nd [ICWHO] [1]
  promoter TSS_2046 1819793 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB