RegulonDB RegulonDB 10.9: Gene Form
   

cheB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cheB cheR cheY TSS_2227 TSS_2227 TSS_2226 TSS_2226 TSS_2225 TSS_2225

Gene      
Name: cheB    Texpresso search in the literature
Synonym(s): ECK1884, EG10147, b1883
Genome position(nucleotides): 1967452 <-- 1968501 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.29
External database links:  
ASAP:
ABE-0006284
CGSC:
927
ECHOBASE:
EB0145
ECOLIHUB:
cheB
OU-MICROARRAY:
b1883
STRING:
511145.b1883
COLOMBOS: cheB


Product      
Name: protein-glutamate methylesterase/protein glutamine deamidase
Synonym(s): CheB, chemotaxis protein CheB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 37.468
Isoelectric point: 8.492
Motif(s):
 
Type Positions Sequence
5 -> 122 RVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYNEM
6 -> 109 VLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQ
58 -> 58 E
96 -> 96 A
191 -> 191 M

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005886 - plasma membrane
molecular_function GO:1990827 - deaminase binding
GO:0050568 - protein-glutamine glutaminase activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0008984 - protein-glutamate methylesterase activity
GO:0000156 - phosphorelay response regulator activity
biological_process GO:0006482 - protein demethylation
GO:0018277 - protein deamination
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0006935 - chemotaxis
GO:0023014 - signal transduction by protein phosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Banno S., et al., 2004
[2] Dang CV., et al., 1986
[3] Kehry MR., et al., 1985
[4] Lai WC., et al., 2005
[5] Parkinson JS. 1978
[6] Rollins CM., et al., 1980
[7] Russell CB., et al., 1989
[8] Saxl RL., et al., 2001
[9] Sherris D., et al., 1981
[10] Stewart RC., et al., 1988
[11] Stewart RC., et al., 1988
External database links:  
DIP:
DIP-9272N
ECOCYC:
CHEB-MONOMER
ECOLIWIKI:
b1883
INTERPRO:
IPR001789
INTERPRO:
IPR035909
INTERPRO:
IPR011006
INTERPRO:
IPR008248
INTERPRO:
IPR000673
MODBASE:
P07330
PFAM:
PF00072
PFAM:
PF01339
PRIDE:
P07330
PRODB:
PRO_000022278
PROSITE:
PS50110
PROSITE:
PS50122
REFSEQ:
NP_416397
SMART:
SM00448
SMR:
P07330
SWISSMODEL:
P07330
UNIPROT:
P07330


Operon      
Name: tar-tap-cheRBYZ         
Operon arrangement:
Transcription unit        Promoter
tar-tap-cheRBYZ


Transcriptional Regulation      
Display Regulation             
Activated by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2225 1967578 reverse nd [RS-EPT-CBR] [12]
  promoter TSS_2226 1967584 reverse nd [RS-EPT-CBR] [12]
  promoter TSS_2227 1968082 reverse nd [RS-EPT-CBR] [12]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Banno S., Shiomi D., Homma M., Kawagishi I., 2004, Targeting of the chemotaxis methylesterase/deamidase CheB to the polar receptor-kinase cluster in an Escherichia coli cell., Mol Microbiol 53(4):1051-63

 [2] Dang CV., Niwano M., Ryu J., Taylor BL., 1986, Inversion of aerotactic response in Escherichia coli deficient in cheB protein methylesterase., J Bacteriol 166(1):275-80

 [3] Kehry MR., Doak TG., Dahlquist FW., 1985, Sensory adaptation in bacterial chemotaxis: regulation of demethylation., J Bacteriol 163(3):983-90

 [4] Lai WC., Hazelbauer GL., 2005, Carboxyl-terminal extensions beyond the conserved pentapeptide reduce rates of chemoreceptor adaptational modification., J Bacteriol 187(15):5115-21

 [5] Parkinson JS., 1978, Complementation analysis and deletion mapping of Escherichia coli mutants defective in chemotaxis., J Bacteriol 135(1):45-53

 [6] Rollins CM., Dahlquist FW., 1980, Methylation of chemotaxis-specific proteins in Escherichia coli cells permeable to S-adenosylmethionine., Biochemistry 19(20):4627-32

 [7] Russell CB., Stewart RC., Dahlquist FW., 1989, Control of transducer methylation levels in Escherichia coli: investigation of components essential for modulation of methylation and demethylation reactions., J Bacteriol 171(7):3609-18

 [8] Saxl RL., Anand GS., Stock AM., 2001, Synthesis and biochemical characterization of a phosphorylated analogue of the response regulator CheB., Biochemistry 40(43):12896-903

 [9] Sherris D., Parkinson JS., 1981, Posttranslational processing of methyl-accepting chemotaxis proteins in Escherichia coli., Proc Natl Acad Sci U S A 78(10):6051-5

 [10] Stewart RC., Dahlquist FW., 1988, N-terminal half of CheB is involved in methylesterase response to negative chemotactic stimuli in Escherichia coli., J Bacteriol 170(12):5728-38

 [11] Stewart RC., Russell CB., Roth AF., Dahlquist FW., 1988, Interaction of CheB with chemotaxis signal transduction components in Escherichia coli: modulation of the methylesterase activity and effects on cell swimming behavior., Cold Spring Harb Symp Quant Biol 53 Pt 1:27-40

 [12] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB