RegulonDB RegulonDB 10.9: Gene Form
   

cirA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cirA lysP yeiG Fur Fur Fur Fur OmrB OmrA cirAp2 cirAp2 cirAp1 cirAp1

Gene      
Name: cirA    Texpresso search in the literature
Synonym(s): ECK2148, EG10155, b2155, cir, feuA
Genome position(nucleotides): 2244778 <-- 2246769 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.76
External database links:  
ASAP:
ABE-0007126
CGSC:
916
ECHOBASE:
EB0153
ECOLIHUB:
cirA
OU-MICROARRAY:
b2155
STRING:
511145.b2155
COLOMBOS: cirA


Product      
Name: iron-catecholate outer membrane transporter CirA
Synonym(s): Cir, CirA, FeuA, colicin I receptor
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 73.896
Isoelectric point: 4.889
Motif(s):
 
Type Positions Sequence
646 -> 663 YSYNEDGRRYFMAVDYRF
97 -> 97 S
31 -> 38 ETMVVTAS
44 -> 152 LKDAPASISVITQEDLQRKPVQNLKDVLKEVPGVQLTNEGDNRKGVSIRGLDSSYTLILVDGKRVNSRNAVFRHNDFDLNWIPVDSIERIEVVRGPMSSLYGSDALGGV
219 -> 662 TTTDTGETPRIEGFSSRDGNVEFAWTPNQNHDFTAGYGFDRQDRDSDSLDKNRLERQNYSVSHNGRWDYGTSELKYYGEKVENKNPGNSSPITSESNTVDGKYTLPLTAINQFLTVGGEWRHDKLSDAVNLTGGTSSKTSASQYALFVEDEWRIFEPLALTTGVRMDDHETYGEHWSPRAYLVYNATDTVTVKGGWATAFKAPSLLQLSPDWTSNSCRGACKIVGSPDLKPETSESWELGLYYMGEEGWLEGVESSVTVFRNDVKDRISISRTSDVNAAPGYQNFVGFETGANGRRIPVFSYYNVNKARIQGVETELKIPFNDEWKLSINYTYNDGRDVSNGENKPLSDLPFHTANGTLDWKPLALEDWSFYVSGHYTGQKRADSATAKTPGGYTIWNTGAAWQVTKDVKLRAGVLNLGDKDLSRDDYSYNEDGRRYFMAVDYR

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.A - Transporters of Unknown Classification
  8 - extrachromosomal --> 8.4 - colicin related
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0031230 - intrinsic component of cell outer membrane
molecular_function GO:0015343 - siderophore transmembrane transporter activity
GO:0042912 - colicin transmembrane transporter activity
GO:0038023 - signaling receptor activity
GO:0015344 - siderophore uptake transmembrane transporter activity
biological_process GO:0006811 - ion transport
GO:0055072 - iron ion homeostasis
GO:0043213 - bacteriocin transport
GO:0044718 - siderophore transmembrane transport
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
Reference(s): [1] Bowles LK., et al., 1983
[2] Jakes KS., et al., 2010
[3] Kleanthous C. 2010
External database links:  
DIP:
DIP-9282N
ECOCYC:
EG10155-MONOMER
ECOLIWIKI:
b2155
INTERPRO:
IPR037066
INTERPRO:
IPR000531
INTERPRO:
IPR010916
INTERPRO:
IPR010917
INTERPRO:
IPR036942
INTERPRO:
IPR039426
INTERPRO:
IPR012910
MINT:
P17315
MODBASE:
P17315
PANTHER:
PTHR30069
PDB:
2HDI
PDB:
2HDF
PFAM:
PF00593
PFAM:
PF07715
PRIDE:
P17315
PRODB:
PRO_000022287
PROSITE:
PS01156
PROSITE:
PS00430
REFSEQ:
NP_416660
SMR:
P17315
UNIPROT:
P17315


Operon      
Name: cirA         
Operon arrangement:
Transcription unit        Promoter
cirA
cirA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: Fur


Regulation by small RNA    
  Display Regulation
small RNA ryhB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Bowles LK., Miguel AG., Konisky J., 1983, Purification of the colicin I receptor., J Biol Chem 258(2):1215-20

 [2] Jakes KS., Finkelstein A., 2010, The colicin Ia receptor, Cir, is also the translocator for colicin Ia., Mol Microbiol 75(3):567-78

 [3] Kleanthous C., 2010, Translocator hunt comes full Cir-Col., Mol Microbiol 75(3):529-33


RegulonDB