RegulonDB RegulonDB 10.8: Gene Form
   

clpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

clpA clpS serW TSS_1053 TSS_1053 TSS_1052 TSS_1052 TSS_1051 TSS_1051 TSS_1050 TSS_1050 TSS_1049 TSS_1049 TSS_1048 TSS_1048 TSS_1047 TSS_1047 TSS_1046 TSS_1046 TSS_1045 TSS_1045 TSS_1044 TSS_1044 TSS_1043 (cluster) TSS_1043 (cluster) TSS_1042 (cluster) TSS_1042 (cluster) TSS_1041 TSS_1041 TSS_1040 TSS_1040 TSS_1039 TSS_1039 TSS_1038 TSS_1038 clpAp3 clpAp3 clpAp2 clpAp2 TSS_1037 TSS_1037 clpAp1 clpAp1 TSS_1036 TSS_1036 TSS_1035 (cluster) TSS_1035 (cluster) TSS_1034 (cluster) TSS_1034 (cluster) TSS_1033 (cluster) TSS_1033 (cluster)

Gene      
Name: clpA    Texpresso search in the literature
Synonym(s): ECK0873, EG10156, b0882, lopD
Genome position(nucleotides): 923264 --> 925540 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.61
External database links:  
ASAP:
ABE-0003001
CGSC:
31293
ECHOBASE:
EB0154
OU-MICROARRAY:
b0882
PortEco:
clpA
STRING:
511145.b0882
COLOMBOS: clpA


Product      
Name: ATP-dependent Clp protease ATP-binding subunit ClpA
Synonym(s): ATP-binding component of serine protease, ClpA, LopD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 84.207
Isoelectric point: 6.249
Motif(s):
 
Type Positions Sequence
211 -> 342 LLVGESGVGKTAIAEGLAWRIVQGDVPEVMADCTIYSLDIGSLLAGTKYRGDFEKRFKALLKQLEQDTNSILFIDEIHTIIGAGAASGGQVDAANLIKPLLSSGKIRVIGSTTYQEFSNIFEKDRALARRFQ
533 -> 533 L
80 -> 145 PTLSFQRVLQRAVFHVQSSGRNEVTGANVLVAIFSEQESQAAYLLRKHEVSRLDVVNFISHGTRKD
350 -> 452 SIEETVQIINGLKPKYEAHHDVRYTAKAVRAAVELAVKYINDRHLPDKAIDVIDEAGARARLMPVSKRKKTVNVADIESVVARIARIPEKSVSQSDRDTLKNL
169 -> 417 MENFTTNLNQLARVGGIDPLIGREKELERAIQVLCRRRKNNPLLVGESGVGKTAIAEGLAWRIVQGDVPEVMADCTIYSLDIGSLLAGTKYRGDFEKRFKALLKQLEQDTNSILFIDEIHTIIGAGAASGGQVDAANLIKPLLSSGKIRVIGSTTYQEFSNIFEKDRALARRFQKIDITEPSIEETVQIINGLKPKYEAHHDVRYTAKAVRAAVELAVKYINDRHLPDKAIDVIDEAGARARLMPVSKR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  2 - information transfer --> 2.3 - protein related --> 2.3.6 - turnover, degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004176 - ATP-dependent peptidase activity
biological_process GO:0006508 - proteolysis
GO:0006979 - response to oxidative stress
GO:0019538 - protein metabolic process
GO:0043335 - protein unfolding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35409N
ECOCYC:
EG10156-MONOMER
ECOLIWIKI:
b0882
INTERPRO:
IPR027417
INTERPRO:
IPR028299
INTERPRO:
IPR036628
INTERPRO:
IPR041546
INTERPRO:
IPR003593
INTERPRO:
IPR001270
INTERPRO:
IPR019489
INTERPRO:
IPR018368
INTERPRO:
IPR013461
INTERPRO:
IPR004176
INTERPRO:
IPR003959
MINT:
P0ABH9
MODBASE:
P0ABH9
PANTHER:
PTHR11638:SF14
PDB:
1R6O
PDB:
1K6K
PDB:
1KSF
PDB:
1LZW
PDB:
1MBU
PDB:
1MBV
PDB:
1MBX
PDB:
1MG9
PDB:
1R6Q
PDB:
5OFO
PDB:
5OG1
PDB:
1R6C
PDB:
1R6B
PFAM:
PF00004
PFAM:
PF10431
PFAM:
PF17871
PFAM:
PF02861
PFAM:
PF07724
PRIDE:
P0ABH9
PRINTS:
PR00300
PRODB:
PRO_000022296
PROSITE:
PS51903
PROSITE:
PS00871
PROSITE:
PS00870
REFSEQ:
NP_415403
SMART:
SM00382
SMART:
SM01086
SMR:
P0ABH9
UNIPROT:
P0ABH9


Operon      
Name: clpA         
Operon arrangement:
Transcription unit        Promoter
clpA
clpA
clpA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1033 (cluster) 923059 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1034 (cluster) 923062 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1035 (cluster) 923067 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1036 923070 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1037 923091 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1038 923211 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1039 923214 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1040 923248 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1041 923326 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1042 (cluster) 923332 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1043 (cluster) 923775 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1044 923778 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1045 923930 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1046 924209 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1047 924234 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1048 924327 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1049 924428 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1050 924863 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1051 925036 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1052 925048 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1053 925971 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB