RegulonDB RegulonDB 10.8: Gene Form
   

cpsG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cpsB wcaJ cpsG terminator wzxCp5 wzxCp5

Gene      
Name: cpsG    Texpresso search in the literature
Synonym(s): ECK2042, EG10162, b2048, manB, rfbK
Genome position(nucleotides): 2121609 <-- 2122979 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.07
External database links:  
ASAP:
ABE-0006788
CGSC:
37429
ECHOBASE:
EB0160
OU-MICROARRAY:
b2048
PortEco:
cpsG
STRING:
511145.b2048
COLOMBOS: cpsG


Product      
Name: phosphomannomutase
Synonym(s): CpsG, ManB, RfbK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 50.463
Isoelectric point: 5.525
Motif(s):
 
Type Positions Sequence
154 -> 258 AYVDHLFGYINVKNLTPLKLVINSGNGAAGPVVDAIEARFKALGAPVELIKVHNTPDGNFPNGIPNPLLPECRDDTRNAVIKHGADMGIAFDGDFDRCFLFDEKG
263 -> 372 GYYIVGLLAEAFLEKNPGAKIIHDPRLSWNTVDVVTAAGGTPVMSKTGHAFIKERMRKEDAIYGGEMSAHHYFRDFAYCDSGMIPWLLVAELVCLKDKTLGELVRDRMAA
7 -> 131 FKAYDIRGKLGEELNEDIAWRIGRAYGEFLKPKTIVLGGDVRLTSETLKLALAKGLQDAGVDVLDIGMSGTEEIYFATFHLGVDGGIEVTASHNPMDYNGMKLVREGARPISGDTGLRDVQRLAE
378 -> 445 EINSKLAQPVEAINRVEQHFSREALAVDRTDGISMTFADWRFNLRTSNTEPVVRLNVESRGDVPLMEA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.10 - sugar nucleotide biosynthesis, conversions
  5 - cell processes --> 5.5 - adaptations --> 5.5.5 - dessication
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
  6 - cell structure --> 6.7 - capsule (M and K antigens)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0016868 - intramolecular transferase activity, phosphotransferases
GO:0004615 - phosphomannomutase activity
GO:0000287 - magnesium ion binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009298 - GDP-mannose biosynthetic process
GO:0071704 - organic substance metabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
PHOSMANMUT-MONOMER
ECOLIWIKI:
b2048
INTERPRO:
IPR005843
INTERPRO:
IPR036900
INTERPRO:
IPR016066
INTERPRO:
IPR016055
INTERPRO:
IPR005846
INTERPRO:
IPR005845
INTERPRO:
IPR005841
INTERPRO:
IPR005844
MODBASE:
P24175
PFAM:
PF00408
PFAM:
PF02878
PFAM:
PF02879
PFAM:
PF02880
PRIDE:
P24175
PRINTS:
PR00509
PRODB:
PRO_000023159
PROSITE:
PS00710
REFSEQ:
NP_416552
SMR:
P24175
UNIPROT:
P24175


Operon      
Name: wcaCDEF-gmd-fcl-gmm-wcaI-cpsBG-wcaJ-wzxC         
Operon arrangement:
Transcription unit        Promoter
wcaCDEF-gmd-fcl-gmm-wcaI-cpsBG-wcaJ-wzxC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter wzxCp5 2120337 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB