RegulonDB RegulonDB 10.9: Gene Form
   

cyaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cyaA hemC cyaY yzcX hemD CRP terminator anti-terminator anti-anti-terminator TSS_4465 TSS_4465 TSS_4464 TSS_4464 TSS_4463 TSS_4463 TSS_4462 TSS_4462 TSS_4461 TSS_4461 TSS_4460 TSS_4460 cyaAp cyaAp TSS_4458 TSS_4458 TSS_4457 TSS_4457 cyaAp1 cyaAp1 cyaAp2 cyaAp2

Gene      
Name: cyaA    Texpresso search in the literature
Synonym(s): ECK3800, EG10170, b3806, cya
Genome position(nucleotides): 3991153 --> 3993699 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.94
External database links:  
ASAP:
ABE-0012432
CGSC:
902
ECHOBASE:
EB0168
ECOLIHUB:
cyaA
OU-MICROARRAY:
b3806
STRING:
511145.b3806
COLOMBOS: cyaA


Product      
Name: adenylate cyclase
Synonym(s): Cya, CyaA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 97.586
Isoelectric point: 6.148
Motif(s):
 
Type Positions Sequence
5 -> 200 IETLKQRLDAINQLRVDRALAAMGPAFQQVYSLLPTLLHYHHPLMPGYLDGNVPKGICLYTPDETQRHYLNELELYRGMSVQDPPKGELPITGVYTMGSTSSVGQSCSSDLDIWVCHQSWLDSEERQLLQRKCSLLENWAASLGVEVSFFLIDENRFRHNESGSLGGEDCGSTQHILLLDEFYRTAVRLAGKRILW
228 -> 825 EWLDLGGLSSLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNPRLLAKDIKQRLHDGEIVSFGLDPYCMMLERVTEYLTAIEDFTRLDLVRRCFYLKVCEKLSRERACVGWRRAVLSQLVSEWGWDEARLAMLDNRANWKIDQVREAHNELLDAMMQSYRNLIRFARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEPNLTFIYVPPGRANRSGWYLYNRAPNIESIISHQPLEYNRYLNKLVAWAWFNGLLTSRTRLYIKGNGIVDLPKLQEMVADVSHHFPLRLPAPTPKALYSPCEIRHLAIIVNLEYDPTAAFRNQVVHFDFRKLDVFSFGENQNCLVGSVDLLYRNSWNEVRTLHFNGEQSMIEALKTILGKMHQDAAPPDSVEVFCYSQHLRGLIRTRVQQLVSECIELRLSSTRQETGRFKALRVSGQTWGLFFERLNVSVQKLENAIEFYGAISHNKLHGLSVQVETNHVKLPAVVDGFASEGIIQFFFEETQDENGFNIYILDESNRVEVYHHCEGSKEELVRDVSRFYSSSHDRFTYGSSFINFNLPQFYQIVKVDGREQVIPFRT
223 -> 223 V
1 -> 535 MYLYIETLKQRLDAINQLRVDRALAAMGPAFQQVYSLLPTLLHYHHPLMPGYLDGNVPKGICLYTPDETQRHYLNELELYRGMSVQDPPKGELPITGVYTMGSTSSVGQSCSSDLDIWVCHQSWLDSEERQLLQRKCSLLENWAASLGVEVSFFLIDENRFRHNESGSLGGEDCGSTQHILLLDEFYRTAVRLAGKRILWNMVPCDEEEHYDDYVMTLYAQGVLTPNEWLDLGGLSSLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNPRLLAKDIKQRLHDGEIVSFGLDPYCMMLERVTEYLTAIEDFTRLDLVRRCFYLKVCEKLSRERACVGWRRAVLSQLVSEWGWDEARLAMLDNRANWKIDQVREAHNELLDAMMQSYRNLIRFARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEPNLTFIYVPPGRANRSGWYLYNRAPNIESIISHQPLEYNRYLNKLVAWAWFNGLLTSRTRLYIKGNGIVDLPKLQEMVADVSHHFPLRL
541 -> 848 KALYSPCEIRHLAIIVNLEYDPTAAFRNQVVHFDFRKLDVFSFGENQNCLVGSVDLLYRNSWNEVRTLHFNGEQSMIEALKTILGKMHQDAAPPDSVEVFCYSQHLRGLIRTRVQQLVSECIELRLSSTRQETGRFKALRVSGQTWGLFFERLNVSVQKLENAIEFYGAISHNKLHGLSVQVETNHVKLPAVVDGFASEGIIQFFFEETQDENGFNIYILDESNRVEVYHHCEGSKEELVRDVSRFYSSSHDRFTYGSSFINFNLPQFYQIVKVDGREQVIPFRTKSIGNMPPANQDHDTPLLQQYFS

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004016 - adenylate cyclase activity
biological_process GO:0006171 - cAMP biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Brickman E., et al., 1973
External database links:  
ECOCYC:
ADENYLATECYC-MONOMER
ECOLIWIKI:
b3806
INTERPRO:
IPR000274
INTERPRO:
IPR024685
INTERPRO:
IPR024686
PANTHER:
PTHR38760
PFAM:
PF12633
PFAM:
PF01295
PRIDE:
P00936
PRODB:
PRO_000022358
PROSITE:
PS01092
PROSITE:
PS01093
REFSEQ:
NP_418250
UNIPROT:
P00936


Operon      
Name: cyaA         
Operon arrangement:
Transcription unit        Promoter
cyaA
cyaA
cyaA


Transcriptional Regulation      
Display Regulation             
Repressed by: CRP


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4457 3990791 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4458 3990952 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4460 3991058 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4461 3991067 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4462 3991069 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4463 3991071 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4464 3991076 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4465 3991152 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Brickman E., Soll L., Beckwith J., 1973, Genetic characterization of mutations which affect catabolite-sensitive operons in Escherichia coli, including deletions of the gene for adenyl cyclase., J Bacteriol 116(2):582-7

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB