RegulonDB RegulonDB 10.9: Gene Form
   

cysC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cysN cysD cysC ygbE TSS_3040 TSS_3040 TSS_3039 TSS_3039 cysCp3 cysCp3 ygbEp3 ygbEp3

Gene      
Name: cysC    Texpresso search in the literature
Synonym(s): ECK2745, EG10185, b2750
Genome position(nucleotides): 2873387 <-- 2873992 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.48
External database links:  
ASAP:
ABE-0009023
CGSC:
896
ECHOBASE:
EB0182
ECOLIHUB:
cysC
OU-MICROARRAY:
b2750
STRING:
511145.b2750
COLOMBOS: cysC


Product      
Name: adenylyl-sulfate kinase
Synonym(s): CysC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 22.321
Isoelectric point: 6.351
Motif(s):
 
Type Positions Sequence
27 -> 179 RGVVLWFTGLSGSGKSTVAGALEEALHKLGVSTYLLDGDNVRHGLCSDLGFSDADRKENIRRVGEVANLMVEAGLVVLTAFISPHRAERQMVRERVGEGRFIEVFVDTPLAICEARDPKGLYKKARAGELRNFTGIDSVYEAPESAEIHLNGE
2 -> 201 ALHDENVVWHSHPVTVQQRELHHGHRGVVLWFTGLSGSGKSTVAGALEEALHKLGVSTYLLDGDNVRHGLCSDLGFSDADRKENIRRVGEVANLMVEAGLVVLTAFISPHRAERQMVRERVGEGRFIEVFVDTPLAICEARDPKGLYKKARAGELRNFTGIDSVYEAPESAEIHLNGEQLVTNLVQQLLDLLRQNDIIRS
134 -> 134 T
35 -> 42 GLSGSGKS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004020 - adenylylsulfate kinase activity
GO:0042802 - identical protein binding
biological_process GO:0016310 - phosphorylation
GO:0000103 - sulfate assimilation
GO:0070814 - hydrogen sulfide biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
ADENYLYLSULFKIN-MONOMER
ECOLIWIKI:
b2750
INTERPRO:
IPR027417
INTERPRO:
IPR002891
MODBASE:
P0A6J1
PFAM:
PF01583
PRIDE:
P0A6J1
PRODB:
PRO_000022375
REFSEQ:
NP_417230
SMR:
P0A6J1
SWISSMODEL:
P0A6J1
UNIPROT:
P0A6J1


Operon      
Name: cysDNC         
Operon arrangement:
Transcription unit        Promoter
cysDNC


Transcriptional Regulation      
Display Regulation             
Activated by: CysB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ygbEp3 2873392 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter cysCp3 2874028 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3039 2875496 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3040 2875544 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB