RegulonDB RegulonDB 10.9: Gene Form
   

cysJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cysJ cysI cysH queD IHF CysB terminator ygcNp3 ygcNp3 TSS_3054 TSS_3054 cysJp cysJp TSS_3053 TSS_3053 TSS_3052 TSS_3052 TSS_3051 (cluster) TSS_3051 (cluster) TSS_3050 TSS_3050 TSS_3049 TSS_3049 TSS_3048 (cluster) TSS_3048 (cluster) TSS_3047 TSS_3047 TSS_3046 (cluster) TSS_3046 (cluster) TSS_3045 TSS_3045 TSS_3044 TSS_3044

Gene      
Name: cysJ    Texpresso search in the literature
Synonym(s): ECK2759, EG10191, b2764
Genome position(nucleotides): 2890099 <-- 2891898 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.06
External database links:  
ASAP:
ABE-0009063
CGSC:
890
ECHOBASE:
EB0188
ECOLIHUB:
cysJ
MIM:
201750
MIM:
613571
OU-MICROARRAY:
b2764
STRING:
511145.b2764
COLOMBOS: cysJ


Product      
Name: sulfite reductase, flavoprotein subunit
Synonym(s): alpha; subunit, CysJ, SiR-FP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 66.27
Isoelectric point: 4.66
Motif(s):
 
Type Positions Sequence
66 -> 196 IISASQTGNARRVAEALRDDLLAAKLNVKLVNAGDYKFKQIASEKLLIVVTSTQGEGEPPEEAVALHKFLFSKKAPKLENTAFAVFSLGDSSYEFFCQSGKDFDSKLAELGGERLLDRVDADVEYQAAASE
268 -> 268 M
386 -> 389 RLYS
153 -> 162 LGDSSYEFFC
519 -> 520 SR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009337 - sulfite reductase complex (NADPH)
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0004783 - sulfite reductase (NADPH) activity
GO:0010181 - FMN binding
GO:0042602 - riboflavin reductase (NADPH) activity
GO:0070401 - NADP+ binding
biological_process GO:0008652 - cellular amino acid biosynthetic process
GO:0019344 - cysteine biosynthetic process
GO:0000103 - sulfate assimilation
GO:0055114 - oxidation-reduction process
GO:0070814 - hydrogen sulfide biosynthetic process
External database links:  
DIP:
DIP-9381N
DISPROT:
DP00190
ECOCYC:
ALPHACOMP-MONOMER
ECOLIWIKI:
b2764
INTERPRO:
IPR023173
INTERPRO:
IPR029758
INTERPRO:
IPR029039
INTERPRO:
IPR039261
INTERPRO:
IPR001094
INTERPRO:
IPR001433
INTERPRO:
IPR001709
INTERPRO:
IPR003097
INTERPRO:
IPR008254
INTERPRO:
IPR010199
INTERPRO:
IPR017927
INTERPRO:
IPR017938
MODBASE:
P38038
PDB:
1YKG
PDB:
1DDI
PDB:
1DDG
PFAM:
PF00667
PFAM:
PF00258
PFAM:
PF00175
PRIDE:
P38038
PRINTS:
PR00369
PRINTS:
PR00371
PRODB:
PRO_000022381
PROSITE:
PS50902
PROSITE:
PS51384
REFSEQ:
NP_417244
SMR:
P38038
UNIPROT:
P38038


Operon      
Name: cysJIH         
Operon arrangement:
Transcription unit        Promoter
cysJIH
cysH


Transcriptional Regulation      
Display Regulation             
Activated by: CysB, IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3044 2888303 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3045 2888316 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3046 (cluster) 2888497 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3047 2888501 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3048 (cluster) 2889307 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3049 2889320 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3050 2890373 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3051 (cluster) 2891032 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3052 2891818 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3053 2891963 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3054 2892190 forward nd [RS-EPT-CBR] [1]
  promoter ygcNp3 2892572 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB