RegulonDB RegulonDB 10.9: Gene Form
   

dapB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: dapB    Texpresso search in the literature
Synonym(s): ECK0032, EG10206, b0031
Genome position(nucleotides): 28374 --> 29195 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.41
External database links:  
ASAP:
ABE-0000112
CGSC:
879
ECHOBASE:
EB0202
ECOLIHUB:
dapB
OU-MICROARRAY:
b0031
STRING:
511145.b0031
COLOMBOS: dapB


Product      
Name: 4-hydroxy-tetrahydrodipicolinate reductase
Synonym(s): DHPR, DapB, dihydrodipicolinate reductase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.757
Isoelectric point: 5.55
Motif(s):
 
Type Positions Sequence
126 -> 129 AANF
12 -> 17 GAGGRM
132 -> 268 GVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFANGAVRSALWLSGKESGLFDMRDVL
169 -> 170 GT
6 -> 129 IRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVFAANF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.7 - lysine
  6 - cell structure --> 6.2 - murein
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0016726 - oxidoreductase activity, acting on CH or CH2 groups, NAD or NADP as acceptor
GO:0008839 - 4-hydroxy-tetrahydrodipicolinate reductase
GO:0042802 - identical protein binding
GO:0050661 - NADP binding
GO:0051287 - NAD binding
biological_process GO:0008652 - cellular amino acid biosynthetic process
GO:0009085 - lysine biosynthetic process
GO:0009089 - lysine biosynthetic process via diaminopimelate
GO:0019877 - diaminopimelate biosynthetic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Boy E., et al., 1976
[2] Ge X., et al., 2007
[3] Mackie GA. 1980
[4] Maringanti S., et al., 1999
[5] Patte JC., et al., 1980
[6] Trigoso YD., et al., 2016
External database links:  
DIP:
DIP-9399N
ECOCYC:
DIHYDROPICRED-MONOMER
ECOLIWIKI:
b0031
INTERPRO:
IPR022664
INTERPRO:
IPR022663
INTERPRO:
IPR000846
INTERPRO:
IPR036291
INTERPRO:
IPR023940
MODBASE:
P04036
PANTHER:
PTHR20836
PDB:
1DRW
PDB:
1DRV
PDB:
1DRU
PDB:
1DIH
PDB:
1ARZ
PFAM:
PF01113
PFAM:
PF05173
PRIDE:
P04036
PRODB:
PRO_000022401
PROSITE:
PS01298
REFSEQ:
NP_414572
SMR:
P04036
UNIPROT:
P04036


Operon      
Name: dapB         
Operon arrangement:
Transcription unit        Promoter
dapB
dapB


Transcriptional Regulation      
Display Regulation             
Activated by: ArgP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_75 28293 forward nd [RS-EPT-CBR] [7]


Reference(s)    

 [1] Boy E., Reinisch F., Richaud C., Patte JC., 1976, Role of lysyl-tRNA in the regulation of lysine biosynthesis in Escherichia coli K12., Biochimie 58(1-2):213-8

 [2] Ge X., Sem DS., 2007, Affinity-based chemical proteomic probe for dehydrogenases: fluorescence and visible binding assays in gels., Anal Biochem 370(2):171-9

 [3] Mackie GA., 1980, Cloning of fragments of lambda dapB2 DNA and identification of the dapB gene product., J Biol Chem 255(18):8928-35

 [4] Maringanti S., Imlay JA., 1999, An intracellular iron chelator pleiotropically suppresses enzymatic and growth defects of superoxide dismutase-deficient Escherichia coli., J Bacteriol 181(12):3792-802

 [5] Patte JC., Morand P., Boy E., Richaud C., Borne F., 1980, The relA locus and the regulation of lysine biosynthesis in Escherichia coli., Mol Gen Genet 179(2):319-25

 [6] Trigoso YD., Evans RC., Karsten WE., Chooback L., 2016, Cloning, Expression, and Purification of Histidine-Tagged Escherichia coli Dihydrodipicolinate Reductase., PLoS One 11(1):e0146525

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB