RegulonDB RegulonDB 10.8: Gene Form
   

dapD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: dapD    Texpresso search in the literature
Synonym(s): ECK0164, EG10207, b0166, ssa
Genome position(nucleotides): 185123 <-- 185947 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.09
Reference(s): [1] Richaud C., et al., 1984
External database links:  
ASAP:
ABE-0000565
CGSC:
877
ECHOBASE:
EB0203
ENTREZ:
K02970
OU-MICROARRAY:
b0166
PortEco:
dapD
STRING:
511145.b0166
COLOMBOS: dapD


Product      
Name: tetrahydrodipicolinate succinylase
Synonym(s): DapD, Ssa
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 29.892
Isoelectric point: 5.436
Motif(s):
 
Type Positions Sequence
3 -> 69 QLQNIIETAFERRAEITPANADTVTREAVNQVIALLDSGALRVAEKIDGQWVTHQWLKKAVLLSFRI
175 -> 209 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIG
163 -> 163 G
133 -> 166 YVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGG
177 -> 177 I

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.7 - lysine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0008666 - 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase activity
biological_process GO:0008652 - cellular amino acid biosynthetic process
GO:0009085 - lysine biosynthetic process
GO:0009089 - lysine biosynthetic process via diaminopimelate
GO:0019877 - diaminopimelate biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [2] Berges DA., et al., 1986
[3] Degryse E. 1991
[4] Maringanti S., et al., 1999
External database links:  
DIP:
DIP-31866N
ECOCYC:
MONOMER0-2001
ECOLIWIKI:
b0166
INTERPRO:
IPR011004
INTERPRO:
IPR037133
INTERPRO:
IPR023180
INTERPRO:
IPR018357
INTERPRO:
IPR005664
INTERPRO:
IPR001451
MODBASE:
P0A9D8
PANTHER:
PTHR19136:SF52
PFAM:
PF14602
PFAM:
PF00132
PFAM:
PF14805
PRIDE:
P0A9D8
PRODB:
PRO_000022402
PROSITE:
PS00101
REFSEQ:
NP_414708
SMR:
P0A9D8
SWISSMODEL:
P0A9D8
UNIPROT:
P0A9D8


Operon      
Name: map-glnD-dapD         
Operon arrangement:
Transcription unit        Promoter
dapD
glnD
 


Transcriptional Regulation      
Display Regulation             
Activated by: ArgP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB