RegulonDB RegulonDB 10.9: Gene Form
   

dedA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

accD truA dedA FadR anti-anti-terminator anti-terminator terminator dedAp2 dedAp2 accDp accDp TSS_2624 TSS_2624 TSS_2623 TSS_2623 TSS_2622 TSS_2622 TSS_2621 TSS_2621

Gene      
Name: dedA    Texpresso search in the literature
Synonym(s): ECK2311, EG10216, b2317
Genome position(nucleotides): 2434082 <-- 2434741 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.94
External database links:  
ASAP:
ABE-0007653
ECHOBASE:
EB0212
ECOLIHUB:
dedA
OU-MICROARRAY:
b2317
STRING:
511145.b2317
COLOMBOS: dedA


Shine dalgarno      
Sequence: agtacaaggcATAGGCaaaTAT


Product      
Name: DedA family protein DedA
Synonym(s): DedA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 24.51
Isoelectric point: 8.887
Motif(s):
 
Type Positions Sequence
188 -> 208 LKLLIVGIIVVSILPGVIEII
49 -> 176 LPGDSLLFVAGALASLETNDLNVHMMVVLMLIAAIVGDAVNYTIGRLFGEKLFSNPNSKIFRRSYLDKTHQFYEKHGGKTIILARFVPIVRTFAPFVAGMGHMSYRHFAAYNVIGALLWVLLFTYAGY
73 -> 93 MMVVLMLIAAIVGDAVNYTIG
46 -> 66 TPFLPGDSLLFVAGALASLET
161 -> 181 VIGALLWVLLFTYAGYFFGTI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48027N
ECOCYC:
EG10216-MONOMER
ECOLIWIKI:
b2317
INTERPRO:
IPR032816
INTERPRO:
IPR032818
PANTHER:
PTHR30353
PFAM:
PF09335
PRIDE:
P0ABP6
PRODB:
PRO_000022423
REFSEQ:
NP_416820
UNIPROT:
P0ABP6


Operon      
Name: pdxB-usg-truA-dedA         
Operon arrangement:
Transcription unit        Promoter
usg-truA-dedA
pdxB-usg-truA-dedA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2621 2433655 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2622 2433908 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2623 2433926 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2624 2433974 reverse nd [RS-EPT-CBR] [1]
  promoter dedAp2 2434940 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB