RegulonDB RegulonDB 10.8: Gene Form
   

dgt gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgt degP mtn btuF CpxR CpxR CpxR TSS_305 TSS_305 degPp degPp TSS_304 TSS_304 TSS_303 (cluster) TSS_303 (cluster) dgtp2 dgtp2 dgtp1 dgtp1 mtnp mtnp TSS_302 TSS_302 TSS_301 TSS_301

Gene      
Name: dgt    Texpresso search in the literature
Synonym(s): ECK0159, EG10225, b0160, optA
Genome position(nucleotides): 179237 --> 180754 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.96
External database links:  
ASAP:
ABE-0000548
CGSC:
30546
ECHOBASE:
EB0221
OU-MICROARRAY:
b0160
PortEco:
dgt
STRING:
511145.b0160
COLOMBOS: dgt


Product      
Name: dGTP triphosphohydrolase
Synonym(s): Dgt, OptA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 59.383
Isoelectric point: 7.512
Motif(s):
 
Type Positions Sequence
2 -> 505 AQIDFRKKINWHRRYRSPQGVKTEHEILRIFESDRGRIINSPAIRRLQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTGPFESIVEMSCLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAESQPLTDDRCSVAALRLRDGEEPLNELRRKIRQDLCHFEGNAQGIRLVHTLMRMNLTWAQVGGILKYTRPAWWRGETPETHHYLMKKPGYYLSEEAYIARLRKELNLALYSRFPLTWIMEAADDISYCVADLEDAVEKRIFTVEQLYHHLHEAWGQHEKGSLFSLVVENAWEKSRSNSLSRSTEDQFFMYLRVNTLNKLVPYAAQRFIDNLPAIFAGTFNHALLEDASECSDLLKLYKNVAVKHVFSHPDVERLELQGYRVISGLLEIYRPLLSLSLSDFTELVEKERVKRFPIESRLFHKLSTRHRLAYVEAVSKLPSDSPEFPLWEYYYRCRLLQDYISGMTDLYAWDEYRRLMAVEQ
363 -> 363 T
66 -> 146 RLTHSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTGPFESIVEMSCLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAE
450 -> 450 R

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003697 - single-stranded DNA binding
GO:0016787 - hydrolase activity
GO:0003924 - GTPase activity
GO:0008832 - dGTPase activity
GO:0016793 - triphosphoric monoester hydrolase activity
GO:0000287 - magnesium ion binding
GO:0030145 - manganese ion binding
GO:0042802 - identical protein binding
GO:0050897 - cobalt ion binding
biological_process GO:0015949 - nucleobase-containing small molecule interconversion
GO:0043099 - pyrimidine deoxyribonucleoside salvage
GO:0006203 - dGTP catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Degryse E. 1991
[2] Quirk S., et al., 1990
External database links:  
DIP:
DIP-9437N
ECOCYC:
DGTPTRIPHYDRO-MONOMER
ECOLIWIKI:
b0160
INTERPRO:
IPR003607
INTERPRO:
IPR006261
INTERPRO:
IPR006674
INTERPRO:
IPR023293
INTERPRO:
IPR020779
MINT:
MINT-1223226
PANTHER:
PTHR11373:SF29
PDB:
6OIX
PDB:
6OIW
PDB:
6OIV
PDB:
6OI7
PDB:
4XDS
PDB:
4X9E
PDB:
6OIY
PFAM:
PF01966
PRIDE:
P15723
PRODB:
PRO_000022437
PROSITE:
PS51831
REFSEQ:
NP_414702
SMART:
SM00471
SMR:
P15723
UNIPROT:
P15723


Operon      
Name: dgt         
Operon arrangement:
Transcription unit        Promoter
dgt
dgt


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_301 178744 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_302 179181 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_303 (cluster) 180836 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_304 180844 forward nd [RS-EPT-CBR] [3]
  promoter TSS_305 180846 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Degryse E., 1991, Polymorphism in the dgt-dapD-tsf region of Escherichia coli K-12 strains., Gene 102(1):141-2

 [2] Quirk S., Bhatnagar SK., Bessman MJ., 1990, Primary structure of the deoxyguanosine triphosphate triphosphohydrolase-encoding gene (dgt) of Escherichia coli., Gene 89(1):13-8

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB