RegulonDB RegulonDB 10.9: Gene Form
   

dnaG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rpoD dnaG rpsU terminator anti-terminator anti-anti-terminator TSS_3377 TSS_3377 TSS_3376 TSS_3376 TSS_3375 TSS_3375 TSS_3374 (cluster) TSS_3374 (cluster) TSS_3373 TSS_3373 TSS_3372 TSS_3372 rpoDp4 rpoDp4 rpoDp3 rpoDp3 rpoDp2 rpoDp2 rpoDp1 rpoDp1

Gene      
Name: dnaG    Texpresso search in the literature
Synonym(s): ECK3056, EG10239, b3066, dnaP, parB, sdgA
Genome position(nucleotides): 3211107 --> 3212852 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.29
External database links:  
ASAP:
ABE-0010065
CGSC:
847
ECHOBASE:
EB0235
ECOLIHUB:
dnaG
OU-MICROARRAY:
b3066
STRING:
511145.b3066
COLOMBOS: dnaG


Product      
Name: DNA primase
Synonym(s): DnaG, DnaP, ParB, SdgA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 65.565
Isoelectric point: 5.83
Motif(s):
 
Type Positions Sequence
165 -> 165 W
259 -> 341 NRLLVVEGYMDVVALAQYGINYAVASLGTSTTADHIQLLFRATNNVICCYDGDRAGRDAAWRALETALPYMTDGRQLRFMFLP
126 -> 251 FYQQSLQQPVATSARQYLEKRGLSHEVIARFAIGFAPPGWDNVLKRFGGNPENRQSLIDAGMLVTNDQGRSYDRFRERVMFPIRDKRGRVIGFGGRVLGNDTPKYLNSPETDIFHKGRQLYGLYEA
24 -> 24 D
199 -> 199 R

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:1990077 - primosome complex
molecular_function GO:0003677 - DNA binding
GO:0016779 - nucleotidyltransferase activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0003899 - DNA-directed 5'-3' RNA polymerase activity
GO:0003896 - DNA primase activity
biological_process GO:0006260 - DNA replication
GO:0006269 - DNA replication, synthesis of RNA primer
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47954N
DISPROT:
DP02134
ECOCYC:
EG10239-MONOMER
ECOLIWIKI:
b3066
INTERPRO:
IPR019475
INTERPRO:
IPR016136
INTERPRO:
IPR013264
INTERPRO:
IPR030846
INTERPRO:
IPR034151
INTERPRO:
IPR036977
INTERPRO:
IPR013173
INTERPRO:
IPR037068
INTERPRO:
IPR002694
INTERPRO:
IPR006171
INTERPRO:
IPR006295
MODBASE:
P0ABS5
PDB:
6CBT
PDB:
6CBS
PDB:
6CBR
PDB:
3B39
PDB:
2HAJ
PDB:
1T3W
PDB:
1EQN
PDB:
1DDE
PDB:
1DD9
PFAM:
PF13155
PFAM:
PF10410
PFAM:
PF08278
PFAM:
PF08275
PFAM:
PF01807
PRIDE:
P0ABS5
PRODB:
PRO_000022463
PROSITE:
PS50880
REFSEQ:
NP_417538
SMART:
SM00766
SMART:
SM00493
SMART:
SM00400
SMR:
P0ABS5
UNIPROT:
P0ABS5


Operon      
Name: rpsU-dnaG-rpoD         
Operon arrangement:
Transcription unit        Promoter
rpsU
rpsU-dnaG-rpoD
rpsU-dnaG-rpoD
rpsU-dnaG-rpoD
rpoD
rpoD
rpoD
rpoD


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3372 3212730 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3373 3212852 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3374 (cluster) 3212941 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3375 3213189 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3376 3213454 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3377 3214325 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB