RegulonDB RegulonDB 10.9: Gene Form
   

dnaX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dnaX apt ybaB Cis-reg; frameshift_element TSS_637 (cluster) TSS_637 (cluster) TSS_636 TSS_636 TSS_635 (cluster) TSS_635 (cluster) ybaBp ybaBp TSS_634 TSS_634 TSS_633 TSS_633 dnaXp dnaXp

Gene      
Name: dnaX    Texpresso search in the literature
Synonym(s): ECK0464, EG10245, b0470, dnaZ
Genome position(nucleotides): 492092 --> 494023 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.66
Note(s):
External database links:  
ASAP:
ABE-0001633
CGSC:
838
ECHOBASE:
EB0241
ECOLIHUB:
dnaX
OU-MICROARRAY:
b0470
STRING:
511145.b0470
COLOMBOS: dnaX


Product      
Name: DNA polymerase III subunit γ
Synonym(s): DnaX, DnaZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 47.545
Isoelectric point: 6.576
Motif(s):
 
Type Positions Sequence
20 -> 178 GQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLKAL
417 -> 498 QQLQRVQGATKAKKSEPAAATRARPVNNAALERLASVTDRVQARPVPSALEKAPAKKEAYRWKATTPVMQQKEVVATPKALK
500 -> 640 ALEHEKTPELAAKLAAEAIERDPWAAQVSQLSLPKLVEQVALNAWKEESDNAVCLHLRSSQRHLNNRGAQQKLAEALSMLKGSTVELTIVEDDNPAVRTPLEWRQAIYEEKLAQARESIIADNNIQTLRRFFDAELDEESI
232 -> 361 VSTQAVSAMLGTLDDDQALSLVEAMVEANGERVMALINEAAARGIEWEALLVEMLGLLHRIAMVQLSPAALGNDMAAIELRMRELARTIPPTDIQLYYQTLLIGRKELPYAPDRRMGVEMTLLRALAFHP
601 -> 601 E

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0043846 - DNA polymerase III, clamp loader complex
GO:0009360 - DNA polymerase III complex
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0017111 - nucleoside-triphosphatase activity
GO:0030337 - DNA polymerase processivity factor activity
GO:0003677 - DNA binding
GO:0003887 - DNA-directed DNA polymerase activity
GO:0016779 - nucleotidyltransferase activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042802 - identical protein binding
biological_process GO:0006259 - DNA metabolic process
GO:0006260 - DNA replication
GO:0006260 - DNA replication
GO:0006261 - DNA-dependent DNA replication
GO:0071897 - DNA biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Hubscher U., et al., 1980
External database links:  
ECOCYC:
MONOMER0-2383
ECOLIWIKI:
b0470
PFAM:
PF12169
PFAM:
PF13177
UNIPROT:
P06710-2


Operon      
Name: dnaX         
Operon arrangement:
Transcription unit        Promoter
dnaX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_633 493064 forward nd [RS-EPT-CBR] [2]
  promoter TSS_634 493071 forward nd [RS-EPT-CBR] [2]
  promoter TSS_635 (cluster) 493804 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_636 494018 forward nd [RS-EPT-CBR] [2]
  promoter TSS_637 (cluster) 494051 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hubscher U., Kornberg A., 1980, The dnaZ protein, the gamma subunit of DNA polymerase III holoenzyme of Escherichia coli., J Biol Chem 255(24):11698-703

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB