RegulonDB RegulonDB 11.0: Gene Form

eno gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

pyrG eno ygcG Cra Cra anti-anti-terminator anti-terminator terminator TSS_3077 TSS_3077 TSS_3076 TSS_3076 enop3 enop3 enop2 enop2 enop1 enop1 TSS_3075 TSS_3075 TSS_3074 (cluster) TSS_3074 (cluster) enop7 enop7 enop5 enop5 TSS_3073 (cluster) TSS_3073 (cluster) enop6 enop6 TSS_3072 (cluster) TSS_3072 (cluster) enop8 enop8 enop4 enop4 TSS_3070 TSS_3070 TSS_3069 TSS_3069 TSS_3068 TSS_3068 TSS_3067 TSS_3067 TSS_3066 TSS_3066 TSS_3065 TSS_3065 TSS_3064 (cluster) TSS_3064 (cluster) TSS_3063 TSS_3063 TSS_3062 TSS_3062 TSS_3061 TSS_3061 TSS_3060 TSS_3060 TSS_3059 TSS_3059 TSS_3058 (cluster) TSS_3058 (cluster) TSS_3057 (cluster) TSS_3057 (cluster) TSS_3056 TSS_3056 TSS_3055 TSS_3055

Name: eno    Texpresso search in the literature
Synonym(s): ECK2773, EG10258, b2779
Genome position(nucleotides): 2906643 <-- 2907941
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: enolase
Synonym(s): Eno
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,extracellular space,cytoskeleton,membrane
Molecular weight: 45.655
Isoelectric point: 5.13
Type Positions Sequence Comment
5 -> 34 VKIIGREIIDSRGNPTVEAEVHLEGGFVGM UniProt: Interaction with RNase E; Sequence Annotation Type: region of interest.
102 -> 102 N UniProt: In Ref. 1; CAA57795/AAA24486..


Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.1 - glycolysis
  1 - metabolism --> 1.7 - central intermediary metabolism
Gene Ontology Terms (GO)  
cellular_component GO:1990061 - bacterial degradosome
GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0016020 - membrane
GO:0000015 - phosphopyruvate hydratase complex
GO:0005576 - extracellular region
GO:0005856 - cytoskeleton
GO:0009986 - cell surface
molecular_function GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0004634 - phosphopyruvate hydratase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006096 - glycolytic process
GO:0006401 - RNA catabolic process
GO:0006396 - RNA processing
External database links:  

Name: pyrG-eno         
Operon arrangement:
Transcription unit        Promoter

Transcriptional Regulation      
Display Regulation             
Repressed by: Cra

RNA cis-regulatory element    
Attenuation: Transcriptional

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3055 2907117 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3056 2907189 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3057 (cluster) 2907196 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3058 (cluster) 2907241 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3059 2907580 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3060 2907627 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3061 2907633 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3062 2907661 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3063 2907662 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3064 (cluster) 2907665 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3065 2907682 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3066 2907694 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3067 2907716 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3068 2907923 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3069 2907932 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3070 2907956 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3072 (cluster) 2907975 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3073 (cluster) 2908021 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3074 (cluster) 2908226 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3075 2908550 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3076 2908879 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3077 2908881 reverse nd [RS-EPT-CBR] [1]


 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates


 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.
