RegulonDB RegulonDB 10.9: Gene Form
   

entD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fepA insL2 entD entDp1 entDp1 entDp2 entDp2

Gene      
Name: entD    Texpresso search in the literature
Synonym(s): ECK0575, EG10262, b0583
Genome position(nucleotides): 609459 <-- 610079 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.5
External database links:  
ASAP:
ABE-0002009
CGSC:
819
ECHOBASE:
EB0258
ECOLIHUB:
entD
OU-MICROARRAY:
b0583
STRING:
511145.b0583
COLOMBOS: entD


Product      
Name: phosphopantetheinyl transferase EntD
Synonym(s): EntD, enterobactin synthetase component D, enterochelin synthase D
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 23.259
Isoelectric point: 6.427
Motif(s):
 
Type Positions Sequence
103 -> 198 PIGIDIEEIFSVQTARELTDNIITPAEHERLADCGLAFSLALTLAFSAKESAFKASEIQTDAGFLDYQIISWNKQQVIIHRENEMFAVHWQIKEKI
37 -> 100 AQLQHAGRKRKTEHLAGRIAAVYALREYGYKCVPAIGELRQPVWPAEVYGSISHCGTTALAVVS
74 -> 75 EL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.14 - enterochelin (enterobactin)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0009366 - enterobactin synthetase complex
GO:0031226 - intrinsic component of plasma membrane
molecular_function GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0016780 - phosphotransferase activity, for other substituted phosphate groups
GO:0008897 - holo-[acyl-carrier-protein] synthase activity
GO:0000287 - magnesium ion binding
biological_process GO:0009237 - siderophore metabolic process
GO:0009239 - enterobactin biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
ENTD-MONOMER
ECOLIWIKI:
b0583
INTERPRO:
IPR041354
INTERPRO:
IPR037143
INTERPRO:
IPR003542
INTERPRO:
IPR008278
MODBASE:
P19925
PANTHER:
PTHR38096
PFAM:
PF01648
PFAM:
PF17837
PRIDE:
P19925
PRINTS:
PR01399
PRODB:
PRO_000022522
REFSEQ:
NP_415115
SMR:
P19925
UNIPROT:
P19925


Operon      
Name: fepA-entD         
Operon arrangement:
Transcription unit        Promoter
fepA-entD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter entDp2 610141 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter entDp1 610254 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB