RegulonDB RegulonDB 10.8: Gene Form
   

fadA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fadB fadA fre TSS_4517 TSS_4517

Gene      
Name: fadA    Texpresso search in the literature
Synonym(s): ECK3837, EG10278, b3845, oldA
Genome position(nucleotides): 4027609 <-- 4028772 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.73
External database links:  
ASAP:
ABE-0012562
CGSC:
794
ECHOBASE:
EB0274
OU-MICROARRAY:
b3845
PortEco:
fadA
STRING:
511145.b3845
COLOMBOS: fadA


Product      
Name: 3-ketoacyl-CoA thiolase
Synonym(s): FadA, OldA, thiolase I
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 40.876
Isoelectric point: 6.781
Motif(s):
 
Type Positions Sequence
371 -> 374 TMCI
37 -> 37 S
261 -> 386 LKPRARVRSMAVVGCDPSIMGYGPVPASKLALKKAGLSASDIGVFEMNEAFAAQILPCIKDLGLIEQIDEKINLNGGAIALGHPLGCSGARISTTLLNLMERKDVQFGLATMCIGLGQGIATVFER
119 -> 119 E
4 -> 254 VVIVDAIRTPMGRSKGGAFRNVRAEDLSAHLMRSLLARNPALEAAALDDIYWGCVQQTLEQGFNIARNAALLAEVPHSVPAVTVNRLCGSSMQALHDAARMIMTGDAQACLVGGVEHMGHVPMSHGVDFHPGLSRNVAKAAGMMGLTAEMLARMHGISREMQDAFAARSHARAWAATQSAAFKNEIIPTGGHDADGVLKQFNYDEVIRPETTVEALATLRPAFDPVNGMVTAGTSSALSDGAAAMLVMSES

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0036125 - fatty acid beta-oxidation multienzyme complex
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups
GO:0003988 - acetyl-CoA C-acyltransferase activity
biological_process GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0010124 - phenylacetate catabolic process
GO:0009062 - fatty acid catabolic process
GO:0016042 - lipid catabolic process
GO:0006635 - fatty acid beta-oxidation
Note(s): Note(s): ...[more].
Reference(s): [1] Binstock JF., et al., 1981
[2] DiRusso CC. 1990
[3] Goh EB., et al., 2012
[4] Kim S., et al., 2015
[5] Mehrer CR., et al., 2018
[6] Nakahigashi K., et al., 1990
[7] Nishimaki-Mogami T., et al., 1987
[8] O'Brien WJ., et al., 1977
[9] Overath P., et al., 1969
[10] Park SJ., et al., 2002
[11] Pramanik A., et al., 1983
[12] Yang SY., et al., 1991
[13] Yang SY., et al., 1990
External database links:  
DIP:
DIP-9559N
ECOCYC:
FADA-MONOMER
ECOLIWIKI:
b3845
INTERPRO:
IPR020610
INTERPRO:
IPR020617
INTERPRO:
IPR020616
INTERPRO:
IPR020615
INTERPRO:
IPR020613
INTERPRO:
IPR016039
INTERPRO:
IPR012805
INTERPRO:
IPR002155
MODBASE:
P21151
PANTHER:
PTHR18919
PFAM:
PF02803
PFAM:
PF00108
PRIDE:
P21151
PROSITE:
PS00737
PROSITE:
PS00099
PROSITE:
PS00098
REFSEQ:
YP_026272
SMR:
P21151
SWISSMODEL:
P21151
UNIPROT:
P21151


Operon      
Name: fadBA         
Operon arrangement:
Transcription unit        Promoter
fadBA


Transcriptional Regulation      
Display Regulation             
Activated by: Fis
Repressed by: FadR, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4517 4027285 forward nd [RS-EPT-CBR] [14]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Binstock JF., Schulz H., 1981, Fatty acid oxidation complex from Escherichia coli., Methods Enzymol 71 Pt C:403-11

 [2] DiRusso CC., 1990, Primary sequence of the Escherichia coli fadBA operon, encoding the fatty acid-oxidizing multienzyme complex, indicates a high degree of homology to eucaryotic enzymes., J Bacteriol 172(11):6459-68

 [3] Goh EB., Baidoo EE., Keasling JD., Beller HR., 2012, Engineering of bacterial methyl ketone synthesis for biofuels., Appl Environ Microbiol 78(1):70-80

 [4] Kim S., Clomburg JM., Gonzalez R., 2015, Synthesis of medium-chain length (C6-C10) fuels and chemicals via β-oxidation reversal in Escherichia coli., J Ind Microbiol Biotechnol 42(3):465-75

 [5] Mehrer CR., Incha MR., Politz MC., Pfleger BF., 2018, Anaerobic production of medium-chain fatty alcohols via a β-reduction pathway., Metab Eng 48:63-71

 [6] Nakahigashi K., Inokuchi H., 1990, Nucleotide sequence of the fadA and fadB genes from Escherichia coli., Nucleic Acids Res 18(16):4937

 [7] Nishimaki-Mogami T., Yamanaka H., Mizugaki M., 1987, Involvement of the fatty acid oxidation complex in acetyl-CoA-dependent chain elongation of fatty acids in Escherichia coli., J Biochem 102(2):427-32

 [8] O'Brien WJ., Frerman FE., 1977, Evidence for a complex of three beta-oxidation enzymes in Escherichia coli: induction and localization., J Bacteriol 132(2):532-40

 [9] Overath P., Pauli G., Schairer HU., 1969, Fatty acid degradation in Escherichia coli. An inducible acyl-CoA synthetase, the mapping of old-mutations, and the isolation of regulatory mutants., Eur J Biochem 7(4):559-74

 [10] Park SJ., Park JP., Lee SY., 2002, Metabolic engineering of Escherichia coli for the production of medium-chain-length polyhydroxyalkanoates rich in specific monomers., FEMS Microbiol Lett 214(2):217-22

 [11] Pramanik A., Schulz H., 1983, Multienzyme complexes of fatty acid oxidation from Escherichia coli K12 and from a mutant with a defective L-3-hydroxyacyl coenzyme A dehydrogenase., Biochim Biophys Acta 750(1):41-6

 [12] Yang SY., He Yang XY., Healy-Louie G., Schulz H., Elzinga M., 1991, Nucleotide sequence of the fadA gene. Primary structure of 3-ketoacyl-coenzyme A thiolase from Escherichia coli and the structural organization of the fadAB operon., J Biol Chem 266(24):16255

 [13] Yang SY., Yang XY., Healy-Louie G., Schulz H., Elzinga M., 1990, Nucleotide sequence of the fadA gene. Primary structure of 3-ketoacyl-coenzyme A thiolase from Escherichia coli and the structural organization of the fadAB operon., J Biol Chem 265(18):10424-9

 [14] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB