RegulonDB RegulonDB 11.0: Gene Form
   

fecE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insI3 fecD fecE yjhV insM fecC terminator anti-terminator anti-anti-terminator terminator fecEp4 fecEp4 fecEp5 fecEp5 fecEp3 fecEp3 insIp5 insIp5 TSS_5123 TSS_5123

Gene      
Name: fecE    Texpresso search in the literature
Synonym(s): ECK4277, EG10290, b4287
Genome position(nucleotides): 4510690 <-- 4511457
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.04
External database links:  
ASAP:
ABE-0014057
CGSC:
35617
ECHOBASE:
EB0286
ECOLIHUB:
fecE
ECOO157CYC:
Z1964
ECOO157CYC:
Z4919
ECOO157CYC:
Z4385
OU-MICROARRAY:
b4287
STRING:
511145.b4287
COLOMBOS: fecE


Product      
Name: ferric citrate ABC transporter ATP binding subunit
Synonym(s): FecE, ferric dicitrate ABC transporter - ATP binding subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 28.191
Isoelectric point: 8.346
Motif(s):
 
Type Positions Sequence Comment
3 -> 238 LRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLGDNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLMGELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVE UniProt: ABC transporter.
18 -> 166 LNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLGDNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPT
35 -> 42 GPNGCGKS UniProt: ATP.
139 -> 142 LSGG
159 -> 166 VVLLDEPT

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
molecular_function GO:0042626 - ATPase-coupled transmembrane transporter activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0006811 - ion transport
GO:0055072 - iron ion homeostasis
GO:0055085 - transmembrane transport
GO:0033212 - iron import into cell
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P15031
ECOCYC:
FECE-MONOMER
ECOLIWIKI:
b4287
ECOO157CYC:
Z4919-MONOMER
ECOO157CYC:
Z4385-MONOMER
ECOO157CYC:
Z1964-MONOMER
INTERPRO:
IPR017871
INTERPRO:
IPR027417
INTERPRO:
IPR003593
INTERPRO:
IPR003439
MODBASE:
P15031
PFAM:
PF00005
PRIDE:
P15031
PRODB:
PRO_000022595
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_418707
SMART:
SM00382
SMR:
P15031
UNIPROT:
P15031


Operon      
Name: fecABCDE         
Operon arrangement:
Transcription unit        Promoter
fecABCDE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, PdhR
Repressed by: Fur, HypT


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5123 4507785 forward nd [RS-EPT-CBR] [1]
  promoter insIp5 4508686 reverse nd [ICWHO] [2]
  promoter fecEp3 4511530 reverse nd [ICWHO] [2]
  promoter fecEp5 4511639 reverse nd [ICWHO] [2]
  promoter fecEp4 4511644 reverse nd [ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB