RegulonDB RegulonDB 10.9: Gene Form
   

fecI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fecA fecR fecI ykiE SlyA Fur Fur Fur Fur Fur Fur Fur PdhR insAp14 insAp14 TSS_5124 TSS_5124 fecIp fecIp fecAp fecAp

Gene      
Name: fecI    Texpresso search in the literature
Synonym(s): ECK4283, EG10291, b4293
Genome position(nucleotides): 4517714 <-- 4518235 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.6
External database links:  
ASAP:
ABE-0014072
CGSC:
35630
ECHOBASE:
EB0287
ECOLIHUB:
fecI
OU-MICROARRAY:
b4293
STRING:
511145.b4293
COLOMBOS: fecI


Product      
Name: RNA polymerase sigma factor FecI
Synonym(s): sigma;19, FecI, RNA polymerase, sigma 19 factor
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.48
Isoelectric point: 6.122
Motif(s):
 
Type Positions Sequence
139 -> 158 YSEIAHKLGVSISSVKKYVA
2 -> 173 SDRATTTASLTFESLYGTHHGWLKSWLTRKLQSAFDADDIAQDTFLRVMVSETLSTIRDPRSFLCTIAKRVMVDLFRRNALEKAYLEMLALMPEGGAPSPEERESQLETLQLLDSMLDGLNGKTREAFLLSQLDGLTYSEIAHKLGVSISSVKKYVAKAVEHCLLFRLEYGL
16 -> 81 LYGTHHGWLKSWLTRKLQSAFDADDIAQDTFLRVMVSETLSTIRDPRSFLCTIAKRVMVDLFRRNA
112 -> 164 QLLDSMLDGLNGKTREAFLLSQLDGLTYSEIAHKLGVSISSVKKYVAKAVEHC
40 -> 52 DIAQDTFLRVMVS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.1 - sigma factors, anti-sigmafactors
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0016987 - sigma factor activity
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0006811 - ion transport
GO:0006352 - DNA-templated transcription, initiation
GO:0055072 - iron ion homeostasis
GO:2000142 - regulation of DNA-templated transcription, initiation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9588N
ECOCYC:
PD00440
ECOLIWIKI:
b4293
INTERPRO:
IPR007627
INTERPRO:
IPR000838
INTERPRO:
IPR013249
INTERPRO:
IPR013324
INTERPRO:
IPR013325
INTERPRO:
IPR014284
INTERPRO:
IPR036388
INTERPRO:
IPR039425
MODBASE:
P23484
PANTHER:
PTHR43133
PFAM:
PF04542
PFAM:
PF08281
PRIDE:
P23484
PROSITE:
PS01063
REFSEQ:
NP_418713
SMR:
P23484
UNIPROT:
P23484


Operon      
Name: fecIR         
Operon arrangement:
Transcription unit        Promoter
fecIR


Transcriptional Regulation      
Display Regulation             
Repressed by: SlyA, Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5124 4518374 forward nd [RS-EPT-CBR] [1]
  promoter insAp14 4518379 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB