RegulonDB RegulonDB 10.9: Gene Form
   

fepB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: fepB    Texpresso search in the literature
Synonym(s): ECK0585, EG10294, b0592
Genome position(nucleotides): 623554 <-- 624510 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.07
External database links:  
ASAP:
ABE-0002038
CGSC:
18385
ECHOBASE:
EB0290
ECOLIHUB:
fepB
OU-MICROARRAY:
b0592
STRING:
511145.b0592
COLOMBOS: fepB


Product      
Name: ferric enterobactin ABC transporter periplasmic binding protein
Synonym(s): FepB
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 34.283
Isoelectric point: 6.033
Motif(s):
 
Type Positions Sequence
27 -> 318 ADWPRQITDSRGTHTLESQPQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIGEPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEITGHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQLGFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLLAHLPAVQNKQVYALGTETFRLDYYSAMQVLDRLKALF
48 -> 318 RIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIGEPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEITGHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQLGFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLLAHLPAVQNKQVYALGTETFRLDYYSAMQVLDRLKALF
1 -> 26 MRLAPLYRNALLLTGLLLSGIAAVQA
49 -> 297 IVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIGEPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEITGHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQLGFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLLAHLPAVQNKQVYALGT

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:1903981 - enterobactin binding
biological_process GO:0006811 - ion transport
GO:0006974 - cellular response to DNA damage stimulus
GO:0055072 - iron ion homeostasis
GO:0042930 - enterobactin transport
GO:0015685 - ferric-enterobactin import into cell
Note(s): Note(s): ...[more].
Reference(s): [1] Chu BC., et al., 2011
External database links:  
DIP:
DIP-9593N
ECOCYC:
FEPB-MONOMER
ECOLIWIKI:
b0592
INTERPRO:
IPR002491
MODBASE:
P0AEL6
PDB:
2M6L
PDB:
3TLK
PDB:
2M6K
PFAM:
PF01497
PRIDE:
P0AEL6
PRODB:
PRO_000022601
PROSITE:
PS50983
REFSEQ:
NP_415124
SMR:
P0AEL6
UNIPROT:
P0AEL6


Operon      
Name: fepB         
Operon arrangement:
Transcription unit        Promoter
fepB


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur, RutR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB