RegulonDB RegulonDB 10.9: Gene Form
   

fepC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

entF fepE fepD fepG fepC ybdZ

Gene      
Name: fepC    Texpresso search in the literature
Synonym(s): ECK0581, EG10295, b0588
Genome position(nucleotides): 619384 <-- 620199 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.92
External database links:  
ASAP:
ABE-0002025
CGSC:
4987
ECHOBASE:
EB0291
ECOLIHUB:
fepC
OU-MICROARRAY:
b0588
STRING:
511145.b0588
COLOMBOS: fepC


Product      
Name: ferric enterobactin ABC transporter ATP binding subunit
Synonym(s): FepC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 29.784
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
24 -> 171 ENLTVEIPDGHFTAIIGPNGCGKSTLLRTLSRLMTPAHGHVWLDGEHIQHYASKEVARRIGLLAQNATTPGDITVQELVARGRYPHQPLFTRWRKEDEEAVTKAMQATGITHLADQSVDTLSGGQRQRAWIAMVLAQETAIMLLDEPT
8 -> 244 LRGEQLTLGYGKYTVAENLTVEIPDGHFTAIIGPNGCGKSTLLRTLSRLMTPAHGHVWLDGEHIQHYASKEVARRIGLLAQNATTPGDITVQELVARGRYPHQPLFTRWRKEDEEAVTKAMQATGITHLADQSVDTLSGGQRQRAWIAMVLAQETAIMLLDEPTTWLDISHQIDLLELLSELNREKGYTLAAVLHDLNQACRYASHLIALREGKIVAQGAPKEIVTAELIERIYGLR
40 -> 47 GPNGCGKS
164 -> 171 IMLLDEPT
227 -> 227 A

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015620 - ferric-enterobactin transmembrane transporter activity
biological_process GO:0006811 - ion transport
GO:0055072 - iron ion homeostasis
GO:0015685 - ferric-enterobactin import into cell
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
FEPC-MONOMER
ECOLIWIKI:
b0588
INTERPRO:
IPR003593
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR003439
MODBASE:
P23878
PFAM:
PF00005
PRIDE:
P23878
PRODB:
PRO_000022602
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_415120
SMART:
SM00382
SMR:
P23878
UNIPROT:
P23878


Operon      
Name: fepDGC         
Operon arrangement:
Transcription unit        Promoter
fepDGC
fepDGC


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB