RegulonDB RegulonDB 10.8: Gene Form
   

fhuC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fhuA fhuB fhuD fhuC terminator TSS_290 TSS_290 TSS_289 TSS_289

Gene      
Name: fhuC    Texpresso search in the literature
Synonym(s): ECK0150, EG10304, b0151
Genome position(nucleotides): 169778 --> 170575 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.89
External database links:  
ASAP:
ABE-0000522
CGSC:
11187
ECHOBASE:
EB0300
OU-MICROARRAY:
b0151
PortEco:
fhuC
STRING:
511145.b0151
COLOMBOS: fhuC


Product      
Name: iron(III) hydroxamate ABC transporter ATP binding subunit
Synonym(s): FhuC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 28.886
Isoelectric point: 7.366
Motif(s):
 
Type Positions Sequence
31 -> 31 S
27 -> 176 LHPLSLTFPAGKVTGLIGHNGSGKSTLLKMLGRHQPPSEGEILLDAQPLESWSSKAFARKVAYLPQQLPPAEGMTVRELVAIGRYPWHGALGRFGAADREKVEEAISLVGLKPLAHRLVDSLSGGERQRAWIAMLVAQDSRCLLLDEPTS
12 -> 248 FALRNISFRVPGRTLLHPLSLTFPAGKVTGLIGHNGSGKSTLLKMLGRHQPPSEGEILLDAQPLESWSSKAFARKVAYLPQQLPPAEGMTVRELVAIGRYPWHGALGRFGAADREKVEEAISLVGLKPLAHRLVDSLSGGERQRAWIAMLVAQDSRCLLLDEPTSALDIAHQVDVLSLVHRLSQERGLTVIAVLHDINMAARYCDYLVALRGGEMIAQGTPAEIMRGETLEMIYGIP
44 -> 51 GHNGSGKS
50 -> 50 K

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0015625 - ATPase-coupled ferric-hydroxamate transmembrane transporter activity
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015623 - ATPase-coupled iron-chelate transporter activity
GO:0015344 - siderophore uptake transmembrane transporter activity
biological_process GO:0006811 - ion transport
GO:0055072 - iron ion homeostasis
GO:0015711 - organic anion transport
GO:0033214 - siderophore-dependent iron import into cell
GO:0015687 - ferric-hydroxamate import into cell
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
FHUC-MONOMER
ECOLIWIKI:
b0151
INTERPRO:
IPR003593
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR003439
MODBASE:
P07821
PFAM:
PF00005
PRIDE:
P07821
PRODB:
PRO_000022611
PROSITE:
PS50893
PROSITE:
PS00211
REFSEQ:
NP_414693
SMART:
SM00382
SMR:
P07821
UNIPROT:
P07821


Operon      
Name: fhuACDB         
Operon arrangement:
Transcription unit        Promoter
fhuACDB


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_289 169733 forward nd [RS-EPT-CBR] [1]
  promoter TSS_290 173420 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB