RegulonDB RegulonDB 10.9: Gene Form
   

fic gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fic ppiA pabA yhfG yhfGp yhfGp pabAp1 pabAp1

Gene      
Name: fic    Texpresso search in the literature
Synonym(s): ECK3349, EG10307, b3361, ficT
Genome position(nucleotides): 3490861 <-- 3491463 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.07
External database links:  
ASAP:
ABE-0010987
CGSC:
18361
ECHOBASE:
EB0303
ECOLIHUB:
fic
OU-MICROARRAY:
b3361
STRING:
511145.b3361
COLOMBOS: fic


Product      
Name: putative adenosine monophosphate—protein transferase Fic
Synonym(s): Fic, FicT, stationary-phase protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 22.96
Isoelectric point: 4.94
Motif(s):
 
Type Positions Sequence
84 -> 85 QG
149 -> 149 F
140 -> 142 GSG
54 -> 195 RGLPHLRTIHRQLYQDIFDWAGQLREVDIYQGDTPFCHFAYIEKEGNALMQDLEEEGYLVGLEKAKFVERLAHYYCEINVLHPFRVGSGLAQRIFFEQLAIHAGYQLSWQGIEKEAWNQANQSGAMGDLTALQMIFSKVVSE
53 -> 54 VR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016779 - nucleotidyltransferase activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0051302 - regulation of cell division
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Checroun C., et al., 2004
[2] Komano T., et al., 1991
[3] Tran PV., et al., 1990
[4] Tran PV., et al., 1991
External database links:  
DIP:
DIP-9608N
ECOCYC:
EG10307-MONOMER
ECOLIWIKI:
b3361
INTERPRO:
IPR003812
INTERPRO:
IPR036597
PDB:
5JFF
PDB:
5JFZ
PFAM:
PF02661
PRIDE:
P20605
PROSITE:
PS51459
REFSEQ:
NP_417820
SMR:
P20605
UNIPROT:
P20605


Operon      
Name: yhfG-fic-pabA         
Operon arrangement:
Transcription unit        Promoter
pabA
yhfG-fic-pabA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Checroun C., Bordes P., Leroy O., Kolb A., Gutierrez C., 2004, Interactions between the 2.4 and 4.2 regions of sigmaS, the stress-specific sigma factor of Escherichia coli, and the -10 and -35 promoter elements., Nucleic Acids Res 32(1):45-53

 [2] Komano T., Utsumi R., Kawamukai M., 1991, Functional analysis of the fic gene involved in regulation of cell division., Res Microbiol 142(2-3):269-77

 [3] Tran PV., Bannor TA., Doktor SZ., Nichols BP., 1990, Chromosomal organization and expression of Escherichia coli pabA., J Bacteriol 172(1):397-410

 [4] Tran PV., Nichols BP., 1991, Expression of Escherichia coli pabA., J Bacteriol 173(12):3680-7


RegulonDB