RegulonDB RegulonDB 10.8: Gene Form
   

fis gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dusB yhdJ fis terminator anti-terminator anti-anti-terminator yhdUp1 yhdUp1 yhdJp2 yhdJp2 TSS_3598 TSS_3598

Gene      
Name: fis    Texpresso search in the literature
Synonym(s): ECK3248, EG10317, b3261, nbp
Genome position(nucleotides): 3411271 --> 3411567 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.14
External database links:  
ASAP:
ABE-0010703
CGSC:
18328
ECHOBASE:
EB0313
OU-MICROARRAY:
b3261
PortEco:
fis
STRING:
511145.b3261
COLOMBOS: fis


Product      
Name: DNA-binding transcriptional dual regulator Fis
Synonym(s): Fis, Nbp, site-specific DNA inversion stimulation factor
Sequence: Get amino acid sequence Fasta Format
Regulator Family: EBP
Cellular location: bacterial nucleoid,cytosol
Molecular weight: 11.24
Isoelectric point: 9.823
Motif(s):
 
Type Positions Sequence
17 -> 44 NSQDQVTQKPLRDSVKQALKNYFAQLNG
74 -> 93 QTRAALMMGINRGTLRKKLK
55 -> 95 LAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKY

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.3 - DNA recombination
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  2 - information transfer --> 2.3 - protein related --> 2.3.7 - nucleoproteins, basic proteins
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0031421 - invertasome
GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009295 - nucleoid
GO:0032993 - protein-DNA complex
GO:0000787 - cytoplasmic nucleosome
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
GO:0042803 - protein homodimerization activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001217 - DNA-binding transcription repressor activity
GO:0000985 - bacterial-type RNA polymerase core promoter sequence-specific DNA binding
GO:0001216 - DNA-binding transcription activator activity
GO:0044374 - sequence-specific DNA binding, bending
biological_process GO:0045911 - positive regulation of DNA recombination
GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0009314 - response to radiation
GO:0032359 - provirus excision
GO:0001121 - bacterial transcription
GO:0034401 - chromatin organization involved in regulation of transcription
Reference(s): [1] Ninnemann O., et al., 1992
[2] Sargentini NJ., et al., 2016
[3] Xu J., et al., 1995
External database links:  
DIP:
DIP-47975N
DISPROT:
DP00422
ECOCYC:
PD00196
ECOLIWIKI:
b3261
ECOO157CYC:
FIS-MONOMER
INTERPRO:
IPR005412
INTERPRO:
IPR002197
INTERPRO:
IPR009057
MINT:
MINT-1225073
MODBASE:
P0A6R3
PDB:
3FIS
PDB:
3IV5
PDB:
3JR9
PDB:
3JRA
PDB:
3JRB
PDB:
3JRC
PDB:
3JRE
PDB:
3JRF
PDB:
3JRG
PDB:
3JRH
PDB:
3JRI
PDB:
4FIS
PDB:
5DS9
PDB:
5DTD
PDB:
5E3L
PDB:
5E3M
PDB:
5E3N
PDB:
5E3O
PDB:
6P0S
PDB:
6P0T
PDB:
6P0U
PDB:
1FIP
PDB:
1FIA
PDB:
1F36
PDB:
1ETY
PDB:
1ETX
PDB:
1ETW
PDB:
1ETV
PDB:
1ETQ
PDB:
1ETO
PDB:
1ETK
PDB:
3JRD
PFAM:
PF02954
PRIDE:
P0A6R3
PRINTS:
PR01591
PRINTS:
PR01590
PRODB:
PRO_000022626
REFSEQ:
NP_417727
SMR:
P0A6R3
UNIPROT:
P0A6R3


Operon      
Name: dusB-fis         
Operon arrangement:
Transcription unit        Promoter
dusB-fis


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, IHF
Repressed by: CRP, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3598 3410739 forward nd [RS-EPT-CBR] [4]
  promoter yhdJp2 3411617 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter yhdUp1 3412497 forward Similarity to the consensus
Read more >
[ICWHO] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Ninnemann O., Koch C., Kahmann R., 1992, The E.coli fis promoter is subject to stringent control and autoregulation., EMBO J 11(3):1075-83

 [2] Sargentini NJ., Gularte NP., Hudman DA., 2016, Screen for genes involved in radiation survival of Escherichia coli and construction of a reference database., Mutat Res 793-794:1-14

 [3] Xu J., Johnson RC., 1995, Fis activates the RpoS-dependent stationary-phase expression of proP in Escherichia coli., J Bacteriol 177(18):5222-31

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB