RegulonDB RegulonDB 10.9: Gene Form
   

fliL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fliK fliM fliL fliJ fliN FlhDC FlhDC TSS_2270 TSS_2270 fliLp2 fliLp2 fliLp1 fliLp1

Gene      
Name: fliL    Texpresso search in the literature
Synonym(s): ECK1942, EG10322, b1944, cheC1, flaAI, flaQI
Genome position(nucleotides): 2019618 --> 2020082 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.33
External database links:  
ASAP:
ABE-0006467
CGSC:
18316
ECHOBASE:
EB0318
ECOLIHUB:
fliL
OU-MICROARRAY:
b1944
STRING:
511145.b1944
COLOMBOS: fliL


Product      
Name: flagellar protein FliL
Synonym(s): FliL
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cell projection
Molecular weight: 17.221
Isoelectric point: 9.326
Motif(s):
 
Type Positions Sequence
56 -> 152 FYALDTFTVNLGDADRVLYIGITLRLKDEATRSRLSEYLPEVRSRLLLLFSRQDAAVLATEEGKKNLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFI
13 -> 35 SLWIPILVFITLAACASAGYSYW

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0009425 - bacterial-type flagellum basal body
molecular_function GO:0042802 - identical protein binding
biological_process GO:0006935 - chemotaxis
GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0071978 - bacterial-type flagellum-dependent swarming motility
GO:0097588 - archaeal or bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Attmannspacher U., et al., 2008
[2] Chawla R., et al., 2017
[3] Partridge JD., et al., 2015
[4] Suzuki T., et al., 1981
External database links:  
ECOCYC:
EG10322-MONOMER
ECOLIWIKI:
b1944
INTERPRO:
IPR005503
PANTHER:
PTHR35091
PFAM:
PF03748
PRIDE:
P0ABX8
PRODB:
PRO_000022663
REFSEQ:
NP_416454
UNIPROT:
P0ABX8


Operon      
Name: fliLMNOPQR         
Operon arrangement:
Transcription unit        Promoter
fliLMNOPQR
fliLMNOPQR


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2270 2020910 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Attmannspacher U., Scharf BE., Harshey RM., 2008, FliL is essential for swarming: motor rotation in absence of FliL fractures the flagellar rod in swarmer cells of Salmonella enterica., Mol Microbiol 68(2):328-41

 [2] Chawla R., Ford KM., Lele PP., 2017, Torque, but not FliL, regulates mechanosensitive flagellar motor-function., Sci Rep 7(1):5565

 [3] Partridge JD., Nieto V., Harshey RM., 2015, A new player at the flagellar motor: FliL controls both motor output and bias., MBio 6(2):e02367

 [4] Suzuki T., Komeda Y., 1981, Incomplete flagellar structures in Escherichia coli mutants., J Bacteriol 145(2):1036-41

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB