RegulonDB RegulonDB 10.9: Gene Form
   

fliN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fliM fliL fliN fliO TSS_2270 TSS_2270

Gene      
Name: fliN    Texpresso search in the literature
Synonym(s): ECK1944, EG10324, b1946, motD
Genome position(nucleotides): 2021088 --> 2021501 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.07
External database links:  
ASAP:
ABE-0006471
CGSC:
18313
ECHOBASE:
EB0320
ECOLIHUB:
fliN
OU-MICROARRAY:
b1946
STRING:
511145.b1946
COLOMBOS: fliN


Product      
Name: flagellar motor switch protein FliN
Synonym(s): FliN, MotD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cell projection
Molecular weight: 14.855
Isoelectric point: 4.202
Motif(s):
 
Type Positions Sequence
1 -> 49 MSDMNNPADDNNGAMDDLWAEALSEQKSTSSKSAAETVFQQFGGGDVSG
56 -> 126 LIMDIPVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGVRITDII

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0009288 - bacterial-type flagellum
GO:0009425 - bacterial-type flagellum basal body
molecular_function GO:0005515 - protein binding
GO:0003774 - motor activity
biological_process GO:0006935 - chemotaxis
GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0097588 - archaeal or bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
Reference(s): [1] Tang H., et al., 1995
External database links:  
DIP:
DIP-1101N
ECOCYC:
FLIN-FLAGELLAR-C-RING-SWITCH
ECOLIWIKI:
b1946
INTERPRO:
IPR012826
INTERPRO:
IPR036429
INTERPRO:
IPR031576
INTERPRO:
IPR001172
INTERPRO:
IPR001543
MODBASE:
P15070
PFAM:
PF16973
PFAM:
PF01052
PRIDE:
P15070
PRINTS:
PR00956
PRODB:
PRO_000022665
REFSEQ:
NP_416456
SMR:
P15070
SWISSMODEL:
P15070
UNIPROT:
P15070


Operon      
Name: fliLMNOPQR         
Operon arrangement:
Transcription unit        Promoter
fliLMNOPQR
fliLMNOPQR


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2270 2020910 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Tang H., Billings S., Wang X., Sharp L., Blair DF., 1995, Regulated underexpression and overexpression of the FliN protein of Escherichia coli and evidence for an interaction between FliN and FliM in the flagellar motor., J Bacteriol 177(12):3496-503

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB