RegulonDB RegulonDB 10.9: Gene Form
   

frdD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ampC frdC frdD anti-anti-terminator anti-terminator terminator anti-anti-terminator anti-terminator terminator TSS_4972 TSS_4972 frdDp7 frdDp7 frdDp1 frdDp1 TSS_4971 TSS_4971 frdDp2 frdDp2 TSS_4970 (cluster) TSS_4970 (cluster) TSS_4969 TSS_4969 TSS_4968 TSS_4968 ampCp ampCp

Gene      
Name: frdD    Texpresso search in the literature
Synonym(s): ECK4147, EG10333, b4151
Genome position(nucleotides): 4379007 <-- 4379366 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.44
External database links:  
ASAP:
ABE-0013595
CGSC:
739
ECHOBASE:
EB0329
ECOLIHUB:
frdD
OU-MICROARRAY:
b4151
STRING:
511145.b4151
COLOMBOS: frdD


Product      
Name: fumarate reductase membrane protein FrdD
Synonym(s): FrdD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 13.107
Isoelectric point: 9.253
Motif(s):
 
Type Positions Sequence
9 -> 35 SDEPVFWGLFGAGGMWSAIIAPVMILL
97 -> 115 GKWVFYGLAAILTVVTLIG
61 -> 89 SFIGRVFLFLMIVLPLWCGLHRMHHAMHD
6 -> 116 PKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.2 - electron acceptors
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0045284 - plasma membrane fumarate reductase complex
molecular_function GO:0102040 - fumarate reductase (menaquinone)
GO:0000104 - succinate dehydrogenase activity
biological_process GO:0006113 - fermentation
GO:0009061 - anaerobic respiration
GO:0006106 - fumarate metabolic process
GO:0044780 - bacterial-type flagellum assembly
Note(s): Note(s): ...[more].
Reference(s): [1] Westenberg DJ., et al., 1993
External database links:  
DIP:
DIP-9684N
ECOCYC:
FUM-MEMB2
ECOLIWIKI:
b4151
INTERPRO:
IPR034804
INTERPRO:
IPR003418
MODBASE:
P0A8Q3
PDB:
1KFY
PDB:
4KX6
PDB:
1KF6
PDB:
5VPN
PDB:
1L0V
PDB:
2B76
PDB:
3CIR
PDB:
3P4P
PDB:
3P4Q
PDB:
3P4R
PDB:
3P4S
PFAM:
PF02313
PRIDE:
P0A8Q3
PRODB:
PRO_000022689
REFSEQ:
NP_418575
SMR:
P0A8Q3
UNIPROT:
P0A8Q3


Operon      
Name: frdABCD         
Operon arrangement:
Transcription unit        Promoter
frdABCD
frdABCD


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, DcuR
Repressed by: NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4968 4379152 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4969 4379156 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4970 (cluster) 4379163 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter frdDp2 4379433 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_4971 4379467 reverse nd [RS-EPT-CBR] [2]
  promoter frdDp1 4379473 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter frdDp7 4379474 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_4972 4379642 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Westenberg DJ., Gunsalus RP., Ackrell BA., Sices H., Cecchini G., 1993, Escherichia coli fumarate reductase frdC and frdD mutants. Identification of amino acid residues involved in catalytic activity with quinones., J Biol Chem 268(2):815-22

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB