RegulonDB RegulonDB 11.0: Gene Form
   

ftsA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ftsA ftsZ ddlB ftsQ murC RcsB SdiA SdiA SdiA Qin prophage;  DicF ppGpp ppGpp ppGpp TSS_192 TSS_192 TSS_191 TSS_191 TSS_190 TSS_190 TSS_189 (cluster) TSS_189 (cluster) TSS_188 TSS_188 TSS_187 TSS_187 TSS_186 TSS_186 ftsZp2 ftsZp2 ftsZp3 ftsZp3 ftsZp4 ftsZp4 TSS_185 TSS_185 TSS_184 TSS_184 TSS_183 TSS_183 TSS_182 TSS_182 TSS_181 TSS_181 ftsAp1 ftsAp1 TSS_180 TSS_180 TSS_179 (cluster) TSS_179 (cluster) TSS_178 TSS_178 TSS_177 TSS_177 TSS_176 TSS_176 ftsQp1 ftsQp1 ftsQp ftsQp TSS_175 TSS_175 ftsQp2 ftsQp2 TSS_174 TSS_174

Gene      
Name: ftsA    Texpresso search in the literature
Synonym(s): ECK0095, EG10339, b0094, divA
Genome position(nucleotides): 103982 --> 105244
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.1
External database links:  
ASAP:
ABE-0000331
CGSC:
738
ECHOBASE:
EB0335
ECOLIHUB:
ftsA
OU-MICROARRAY:
b0094
STRING:
511145.b0094
COLOMBOS: ftsA


Product      
Name: cell division protein FtsA
Synonym(s): DivA, FtsA, essential cell division protein FtsA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 45.33
Isoelectric point: 6.198
Motif(s):
 
Type Positions Sequence Comment
85 -> 162 GKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLIT
207 -> 381 CVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVG
210 -> 210 D UniProt: Does not bind ATP..
339 -> 339 A UniProt: In Ref. 1 and 3..
408 -> 408 W UniProt: Prevents localization to the Z ring. Lack of activity..

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:1990586 - divisome complex
GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0009898 - cytoplasmic side of plasma membrane
GO:0032153 - cell division site
molecular_function GO:0005515 - protein binding
GO:0005524 - ATP binding
GO:0042802 - identical protein binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0043093 - FtsZ-dependent cytokinesis
GO:0000917 - division septum assembly
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Busiek KK., et al., 2012
[2] Dai K., et al., 1993
[3] Du S., et al., 2019
[4] Du S., et al., 2016
[5] Du S., et al., 2020
[6] Herricks JR., et al., 2014
[7] Ho SH., et al., 2019
[8] Jimenez M., et al., 2011
[9] Liu B., et al., 2015
[10] Park KT., et al., 2021
[11] Pichoff S., et al., 2015
[12] Pichoff S., et al., 2018
[13] Pichoff S., et al., 2012
[14] Ricard M., et al., 1973
[15] Shen B., et al., 2009
[16] Weiss DS., et al., 1999
External database links:  
ALPHAFOLD:
P0ABH0
DIP:
DIP-47983N
ECOCYC:
EG10339-MONOMER
ECOLIWIKI:
b0094
INTERPRO:
IPR020823
INTERPRO:
IPR043129
INTERPRO:
IPR003494
MINT:
P0ABH0
MODBASE:
P0ABH0
PFAM:
PF02491
PFAM:
PF14450
PRIDE:
P0ABH0
PRODB:
PRO_000022714
REFSEQ:
NP_414636
SMART:
SM00842
SMR:
P0ABH0
UNIPROT:
P0ABH0


Operon      
Name: mraZ-rsmH-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC         
Operon arrangement:
Transcription unit        Promoter
mraZW-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
rsmH-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsQ
ftsQAZ
ftsQAZ
ftsAZ
ftsZ
ftsZ
ftsZ
lpxC
lpxC


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB
Repressed by: MraZ, LexA, SdiA, PdhR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_174 102679 forward nd [RS-EPT-CBR] [17]
  promoter TSS_175 102865 forward nd [RS-EPT-CBR] [17]
  promoter TSS_176 102872 forward nd [RS-EPT-CBR] [17]
  promoter TSS_177 103019 forward nd [RS-EPT-CBR] [17]
  promoter TSS_178 103024 forward nd [RS-EPT-CBR] [17]
  promoter TSS_179 (cluster) 103028 forward nd [RS-EPT-CBR] [17]
  promoter TSS_180 103133 forward nd [RS-EPT-CBR] [17]
  promoter TSS_181 103608 forward nd [RS-EPT-CBR] [17]
  promoter TSS_182 103889 forward nd [RS-EPT-CBR] [17]
  promoter TSS_183 103960 forward nd [RS-EPT-CBR] [17]
  promoter TSS_184 104188 forward nd [RS-EPT-CBR] [17]
  promoter TSS_185 104305 forward nd [RS-EPT-CBR] [17]
  promoter TSS_186 105087 forward nd [RS-EPT-CBR] [17]
  promoter TSS_187 105093 forward nd [RS-EPT-CBR] [17]
  promoter TSS_188 105291 forward nd [RS-EPT-CBR] [17]
  promoter TSS_189 (cluster) 105669 forward nd [RS-EPT-CBR] [17]
  promoter TSS_190 105677 forward nd [RS-EPT-CBR] [17]
  promoter TSS_191 105795 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_192 105816 forward nd [RS-EPT-CBR] [17]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Busiek KK., Eraso JM., Wang Y., Margolin W., 2012, The early divisome protein FtsA interacts directly through its 1c subdomain with the cytoplasmic domain of the late divisome protein FtsN., J Bacteriol 194(8):1989-2000

 [2] Dai K., Xu Y., Lutkenhaus J., 1993, Cloning and characterization of ftsN, an essential cell division gene in Escherichia coli isolated as a multicopy suppressor of ftsA12(Ts)., J Bacteriol 175(12):3790-7

 [3] Du S., Henke W., Pichoff S., Lutkenhaus J., 2019, How FtsEX localizes to the Z ring and interacts with FtsA to regulate cell division., Mol Microbiol 112(3):881-895

 [4] Du S., Pichoff S., Lutkenhaus J., 2016, FtsEX acts on FtsA to regulate divisome assembly and activity., Proc Natl Acad Sci U S A 113(34):E5052-61

 [5] Du S., Pichoff S., Lutkenhaus J., 2020, Roles of ATP Hydrolysis by FtsEX and Interaction with FtsA in Regulation of Septal Peptidoglycan Synthesis and Hydrolysis., mBio 11(4)

 [6] Herricks JR., Nguyen D., Margolin W., 2014, A thermosensitive defect in the ATP binding pocket of FtsA can be suppressed by allosteric changes in the dimer interface., Mol Microbiol 94(3):713-27

 [7] Ho SH., Tirrell DA., 2019, Enzymatic Labeling of Bacterial Proteins for Super-resolution Imaging in Live Cells., ACS Cent Sci 5(12):1911-1919

 [8] Jimenez M., Martos A., Vicente M., Rivas G., 2011, Reconstitution and organization of Escherichia coli proto-ring elements (FtsZ and FtsA) inside giant unilamellar vesicles obtained from bacterial inner membranes., J Biol Chem 286(13):11236-41

 [9] Liu B., Persons L., Lee L., de Boer PA., 2015, Roles for both FtsA and the FtsBLQ subcomplex in FtsN-stimulated cell constriction in Escherichia coli., Mol Microbiol 95(6):945-70

 [10] Park KT., Pichoff S., Du S., Lutkenhaus J., 2021, FtsA acts through FtsW to promote cell wall synthesis during cell division in Escherichia coli., Proc Natl Acad Sci U S A 118(35)

 [11] Pichoff S., Du S., Lutkenhaus J., 2015, The bypass of ZipA by overexpression of FtsN requires a previously unknown conserved FtsN motif essential for FtsA-FtsN interaction supporting a model in which FtsA monomers recruit late cell division proteins to the Z ring., Mol Microbiol 95(6):971-87

 [12] Pichoff S., Du S., Lutkenhaus J., 2018, Disruption of divisome assembly rescued by FtsN-FtsA interaction in Escherichia coli., Proc Natl Acad Sci U S A 115(29):E6855-E6862

 [13] Pichoff S., Shen B., Sullivan B., Lutkenhaus J., 2012, FtsA mutants impaired for self-interaction bypass ZipA suggesting a model in which FtsA's self-interaction competes with its ability to recruit downstream division proteins., Mol Microbiol 83(1):151-67

 [14] Ricard M., Hirota Y., 1973, Process of cellular division in Escherichia coli: physiological study on thermosensitive mutants defective in cell division., J Bacteriol 116(1):314-22

 [15] Shen B., Lutkenhaus J., 2009, The conserved C-terminal tail of FtsZ is required for the septal localization and division inhibitory activity of MinC(C)/MinD., Mol Microbiol 72(2):410-24

 [16] Weiss DS., Chen JC., Ghigo JM., Boyd D., Beckwith J., 1999, Localization of FtsI (PBP3) to the septal ring requires its membrane anchor, the Z ring, FtsA, FtsQ, and FtsL., J Bacteriol 181(2):508-20

 [17] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB