RegulonDB RegulonDB 11.0: Gene Form
   

ftsQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ftsA ftsZ ddlB ftsQ murC RcsB SdiA SdiA SdiA Qin prophage;  DicF ppGpp ppGpp ppGpp TSS_192 TSS_192 TSS_191 TSS_191 TSS_190 TSS_190 TSS_189 (cluster) TSS_189 (cluster) TSS_188 TSS_188 TSS_187 TSS_187 TSS_186 TSS_186 ftsZp2 ftsZp2 ftsZp3 ftsZp3 ftsZp4 ftsZp4 TSS_185 TSS_185 TSS_184 TSS_184 TSS_183 TSS_183 TSS_182 TSS_182 TSS_181 TSS_181 ftsAp1 ftsAp1 TSS_180 TSS_180 TSS_179 (cluster) TSS_179 (cluster) TSS_178 TSS_178 TSS_177 TSS_177 TSS_176 TSS_176 ftsQp1 ftsQp1 ftsQp ftsQp TSS_175 TSS_175 ftsQp2 ftsQp2 TSS_174 TSS_174

Gene      
Name: ftsQ    Texpresso search in the literature
Synonym(s): ECK0094, EG10342, b0093
Genome position(nucleotides): 103155 --> 103985
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.31
External database links:  
ASAP:
ABE-0000329
CGSC:
734
ECHOBASE:
EB0338
ECOLIHUB:
ftsQ
OU-MICROARRAY:
b0093
STRING:
511145.b0093
COLOMBOS: ftsQ


Product      
Name: cell division protein FtsQ
Synonym(s): FtsQ, essential cell division protein FtsQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 31.434
Isoelectric point: 6.825
Motif(s):
 
Type Positions Sequence Comment
28 -> 48 ILFLLTVLTTVLVSGWVVLGW UniProt: Helical.
29 -> 29 L UniProt: No change in activity. Correctly assembled, interacts with FtsB and FtsL, but fails to localize efficiently to the cell division site; when associated with R-32. Does not insert into the membrane and lack of activity; when associated with R-32 and P-38..
32 -> 32 L UniProt: No change in activity. Correctly assembled, interacts with FtsB and FtsL, but fails to localize efficiently to the cell division site; when associated with R-29. Does not insert into the membrane and lack of activity; when associated with R-29 and P-38..
38 -> 38 V UniProt: No change in activity. Does not insert into the membrane and lack of activity; when associated with R-29 and R-32..
55 -> 126 LPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEY UniProt: POTRA.

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:1990586 - divisome complex
GO:1990587 - FtsQBL complex
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0032153 - cell division site
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0043093 - FtsZ-dependent cytokinesis
GO:0000917 - division septum assembly
GO:0090529 - cell septum assembly
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Begg KJ., et al., 1980
[2] Svanberg Frisinger F., et al., 2021
External database links:  
ALPHAFOLD:
P06136
DIP:
DIP-9706N
ECOCYC:
EG10342-MONOMER
ECOLIWIKI:
b0093
INTERPRO:
IPR026579
INTERPRO:
IPR034746
INTERPRO:
IPR013685
INTERPRO:
IPR005548
MINT:
P06136
PANTHER:
PTHR35851
PDB:
5Z2W
PDB:
6H9N
PDB:
6H9O
PDB:
4V6M
PDB:
2VH1
PDB:
4UE4
PFAM:
PF03799
PFAM:
PF08478
PRIDE:
P06136
PRODB:
PRO_000022722
PROSITE:
PS51779
REFSEQ:
NP_414635
SMR:
P06136
UNIPROT:
P06136


Operon      
Name: mraZ-rsmH-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC         
Operon arrangement:
Transcription unit        Promoter
mraZW-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
rsmH-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsQ
ftsQAZ
ftsQAZ
ftsAZ
ftsZ
ftsZ
ftsZ
lpxC
lpxC


Transcriptional Regulation      
Display Regulation             
Activated by: SdiA
Repressed by: MraZ, LexA, SdiA, PdhR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_174 102679 forward nd [RS-EPT-CBR] [3]
  promoter TSS_175 102865 forward nd [RS-EPT-CBR] [3]
  promoter TSS_176 102872 forward nd [RS-EPT-CBR] [3]
  promoter TSS_177 103019 forward nd [RS-EPT-CBR] [3]
  promoter TSS_178 103024 forward nd [RS-EPT-CBR] [3]
  promoter TSS_179 (cluster) 103028 forward nd [RS-EPT-CBR] [3]
  promoter TSS_180 103133 forward nd [RS-EPT-CBR] [3]
  promoter TSS_181 103608 forward nd [RS-EPT-CBR] [3]
  promoter TSS_182 103889 forward nd [RS-EPT-CBR] [3]
  promoter TSS_183 103960 forward nd [RS-EPT-CBR] [3]
  promoter TSS_184 104188 forward nd [RS-EPT-CBR] [3]
  promoter TSS_185 104305 forward nd [RS-EPT-CBR] [3]
  promoter TSS_186 105087 forward nd [RS-EPT-CBR] [3]
  promoter TSS_187 105093 forward nd [RS-EPT-CBR] [3]
  promoter TSS_188 105291 forward nd [RS-EPT-CBR] [3]
  promoter TSS_189 (cluster) 105669 forward nd [RS-EPT-CBR] [3]
  promoter TSS_190 105677 forward nd [RS-EPT-CBR] [3]
  promoter TSS_191 105795 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_192 105816 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Begg KJ., Hatfull GF., Donachie WD., 1980, Identification of new genes in a cell envelope-cell division gene cluster of Escherichia coli: cell division gene ftsQ., J Bacteriol 144(1):435-7

 [2] Svanberg Frisinger F., Jana B., Donadio S., Guardabassi L., 2021, In Silico Prediction and Prioritization of Novel Selective Antimicrobial Drug Targets in Escherichia coli., Antibiotics (Basel) 10(6)

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB