RegulonDB RegulonDB 10.9: Gene Form
   

fucI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fucI fucK fucP terminator fucUp fucUp

Gene      
Name: fucI    Texpresso search in the literature
Synonym(s): ECK2797, EG10349, b2802
Genome position(nucleotides): 2935584 --> 2937359 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.5
External database links:  
ASAP:
ABE-0009189
CGSC:
10878
ECHOBASE:
EB0345
ECOLIHUB:
fucI
OU-MICROARRAY:
b2802
STRING:
511145.b2802
COLOMBOS: fucI


Product      
Name: L-fucose isomerase
Synonym(s): FucI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 64.977
Isoelectric point: 5.741
Motif(s):
 
Type Positions Sequence
7 -> 174 PKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALLTEKLRHACGAAVECVISDTCIAGMAEAAACEEKFSSQNVGLTITVTPCWCYGSETIDMDPTRPKAIWGFNGTERPGAVYLAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFARAGLAVASMKG
390 -> 554 LINSGSAALDGSCKQRDSEGNPTMKPHWEISQQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWSVELPKDVHDILNKRTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADFITLASMLRIPVCMH
8 -> 8 K
175 -> 354 KSYLSLGGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRYGEDENNKQYQRNAEQSRAVLRESLLMAMCIRDMMQGNSKLADIGRVEESLGYNAIAAGFQGQRHWTDQYPNGDTAEAILNSSFDWNGVREPFVVATENDSLNGVAMLMGHQLTG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0016861 - intramolecular oxidoreductase activity, interconverting aldoses and ketoses
GO:0008736 - L-fucose isomerase activity
GO:0008790 - arabinose isomerase activity
GO:0030145 - manganese ion binding
GO:0042802 - identical protein binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0005996 - monosaccharide metabolic process
GO:0006004 - fucose metabolic process
GO:0019317 - fucose catabolic process
GO:0019571 - D-arabinose catabolic process
GO:0042355 - L-fucose catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
FUCISOM-MONOMER
ECOLIWIKI:
b2802
INTERPRO:
IPR005763
INTERPRO:
IPR038393
INTERPRO:
IPR004216
INTERPRO:
IPR038392
INTERPRO:
IPR009015
INTERPRO:
IPR012888
INTERPRO:
IPR012889
INTERPRO:
IPR015888
INTERPRO:
IPR038391
MODBASE:
P69922
PDB:
1FUI
PFAM:
PF02952
PFAM:
PF07881
PFAM:
PF07882
PRIDE:
P69922
PRODB:
PRO_000022728
REFSEQ:
NP_417282
SMR:
P69922
UNIPROT:
P69922


Operon      
Name: fucPIKUR         
Operon arrangement:
Transcription unit        Promoter
fucPIKUR
fucU
fucR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FucR


Regulation by small RNA    
  Display Regulation
small RNA spf


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB