RegulonDB RegulonDB 10.9: Gene Form
   

fumB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fumB dcuB yjdF NarL NarL NarL FNR FNR FNR TSS_4923 (cluster) TSS_4923 (cluster) fumBp fumBp

Gene      
Name: fumB    Texpresso search in the literature
Synonym(s): ECK4115, EG10357, b4122
Genome position(nucleotides): 4345680 <-- 4347326 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.64
External database links:  
ASAP:
ABE-0013501
CGSC:
18289
ECHOBASE:
EB0352
ECOLIHUB:
fumB
OU-MICROARRAY:
b4122
STRING:
511145.b4122
COLOMBOS: fumB


Shine dalgarno      
Sequence: atacagagttACAGGCtggaagcTAT


Product      
Name: fumarase B
Synonym(s): FumB
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 60.105
Isoelectric point: 6.237
Motif(s):
 
Type Positions Sequence
50 -> 50 L
51 -> 326 AQQAFHDASFMLRPAHQKQVAAILHDPEASENDKYVALQFLRNSEIAAKGVLPTCQDTGTAIIVGKKGQRVWTGGGDEETLSKGVYNTYIEDNLRYSQNAALDMYKEVNTGTNLPAQIDLYAVDGDEYKFLCVAKGGGSANKTYLYQETKALLTPGKLKNFLVEKMRTLGTAACPPYHIAFVIGGTSAETNLKTVKLASAHYYDELPTEGNEHGQAFRDVQLEQELLEEAQKLGLGAQFGGKYFAHDIRVIRLPRHGASCPVGMGVSCSADRNIKA
332 -> 537 GIWIEKLEHNPGQYIPQELRQAGEGEAVKVDLNRPMKEILAQLSQYPVSTRLSLTGTIIVGRDIAHAKLKELIDAGKELPQYIKDHPIYYAGPAKTPAGYPSGSLGPTTAGRMDSYVDLLQSHGGSMIMLAKGNRSQQVTDACHKHGGFYLGSIGGPAAVLAQQSIKHLECVAYPELGMEAIWKIEVEDFPAFILVDDKGNDFFQQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.4 - TCA cycle
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
Gene Ontology Terms (GO)  
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0016836 - hydro-lyase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0004333 - fumarate hydratase activity
GO:0042803 - protein homodimerization activity
GO:0047808 - D(-)-tartrate dehydratase activity
biological_process GO:0006091 - generation of precursor metabolites and energy
GO:0006099 - tricarboxylic acid cycle
GO:0006974 - cellular response to DNA damage stimulus
GO:0044010 - single-species biofilm formation
Note(s): Note(s): ...[more].
Reference(s): [1] Bell PJ., et al., 1989
[2] Gray CT., et al., 1966
[3] Guest JR., et al., 1992
[4] Overton TW., et al., 2006
External database links:  
ECOCYC:
FUMB-MONOMER
ECOLIWIKI:
b4122
INTERPRO:
IPR004646
INTERPRO:
IPR036660
INTERPRO:
IPR020557
INTERPRO:
IPR004647
INTERPRO:
IPR011167
PFAM:
PF05681
PFAM:
PF05683
PRIDE:
P14407
PRODB:
PRO_000022735
PROSITE:
PS00163
REFSEQ:
NP_418546
SMR:
P14407
UNIPROT:
P14407


Operon      
Name: dcuB-fumB         
Operon arrangement:
Transcription unit        Promoter
fumB
dcuB-fumB
dcuB-fumB


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Fur, FNR, DcuR, ArcA
Repressed by: NarL, Fis
Growth Conditions:

[1] 

C: Escherichia coli| L broth| fumarate 50 mM; glycerol 0.4%| oxygen atom| mid exponential phase
E: Escherichia coli| L broth| fumarate 50 mM; glycerol 0.4%| mid exponential phase



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4923 (cluster) 4347981 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bell PJ., Andrews SC., Sivak MN., Guest JR., 1989, Nucleotide sequence of the FNR-regulated fumarase gene (fumB) of Escherichia coli K-12., J Bacteriol 171(6):3494-503

 [2] Gray CT., Wimpenny JW., Mossman MR., 1966, Regulation of metabolism in facultative bacteria. II. Effects of aerobiosis, anaerobiosis and nutrition on the formation of Krebs cycle enzymes in Escherichia coli., Biochim Biophys Acta 117(1):33-41

 [3] Guest JR., Russell GC., 1992, Complexes and complexities of the citric acid cycle in Escherichia coli., Curr Top Cell Regul 33:231-47

 [4] Overton TW., Griffiths L., Patel MD., Hobman JL., Penn CW., Cole JA., Constantinidou C., 2006, Microarray analysis of gene regulation by oxygen, nitrate, nitrite, FNR, NarL and NarP during anaerobic growth of Escherichia coli: new insights into microbial physiology., Biochem Soc Trans 34(Pt 1):104-7

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB