RegulonDB RegulonDB 10.9: Gene Form
   

gcvH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gcvP gcvT gcvH TSS_3176 TSS_3176

Gene      
Name: gcvH    Texpresso search in the literature
Synonym(s): ECK2899, EG10371, b2904, gcv
Genome position(nucleotides): 3049160 <-- 3049549 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.56
External database links:  
ASAP:
ABE-0009534
CGSC:
28664
ECHOBASE:
EB0366
ECOLIHUB:
gcvH
MIM:
605899
NCBI-GENE:
947393
OU-MICROARRAY:
b2904
STRING:
511145.b2904
COLOMBOS: gcvH


Product      
Name: glycine cleavage system H protein
Synonym(s): Gcv, GcvH, H-protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.811
Isoelectric point: 3.719
Motif(s):
 
Type Positions Sequence
2 -> 129 SNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVKAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLEDE
8 -> 128 LKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVKAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLED
24 -> 106 TYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVKAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.17 - formyl-THF biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005960 - glycine cleavage complex
molecular_function GO:0031405 - lipoic acid binding
biological_process GO:0019464 - glycine decarboxylation via glycine cleavage system
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Plamann MD., et al., 1983
[2] Ravnikar PD., et al., 1987
[3] Reed KE., et al., 1993
[4] Vanden Boom TJ., et al., 1991
External database links:  
ECOCYC:
GCVH-MONOMER
ECOLIWIKI:
b2904
INTERPRO:
IPR002930
INTERPRO:
IPR000089
INTERPRO:
IPR033753
INTERPRO:
IPR003016
INTERPRO:
IPR011053
INTERPRO:
IPR017453
MODBASE:
P0A6T9
PANTHER:
PTHR11715
PDB:
3AB9
PDB:
3A8K
PDB:
3A8J
PDB:
3A8I
PDB:
3A7L
PDB:
3A7A
PFAM:
PF01597
PRIDE:
P0A6T9
PRODB:
PRO_000022763
PROSITE:
PS50968
PROSITE:
PS00189
REFSEQ:
NP_417380
SMR:
P0A6T9
SWISSMODEL:
P0A6T9
UNIPROT:
P0A6T9


Operon      
Name: gcvTHP         
Operon arrangement:
Transcription unit        Promoter
gcvTHP
gcvP


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, GcvA, FNR, Lrp
Repressed by: PurR, GcvA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3176 3048166 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Plamann MD., Rapp WD., Stauffer GV., 1983, Escherichia coli K12 mutants defective in the glycine cleavage enzyme system., Mol Gen Genet 192(1-2):15-20

 [2] Ravnikar PD., Somerville RL., 1987, Genetic characterization of a highly efficient alternate pathway of serine biosynthesis in Escherichia coli., J Bacteriol 169(6):2611-7

 [3] Reed KE., Cronan JE., 1993, Lipoic acid metabolism in Escherichia coli: sequencing and functional characterization of the lipA and lipB genes., J Bacteriol 175(5):1325-36

 [4] Vanden Boom TJ., Reed KE., Cronan JE., 1991, Lipoic acid metabolism in Escherichia coli: isolation of null mutants defective in lipoic acid biosynthesis, molecular cloning and characterization of the E. coli lip locus, and identification of the lipoylated protein of the glycine cleavage system., J Bacteriol 173(20):6411-20

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB