RegulonDB RegulonDB 10.9: Gene Form
   

glgB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glgB glgX glgC yhgO yhgP PhoP ppGpp ppGpp glgBp glgBp TSS_4049 TSS_4049 TSS_4048 TSS_4048 TSS_4047 TSS_4047 TSS_4046 TSS_4046 TSS_4045 TSS_4045 TSS_4044 TSS_4044 glgXp3 glgXp3 TSS_4043 TSS_4043 TSS_4042 TSS_4042 TSS_4041 TSS_4041 glgCp3 glgCp3 TSS_4040 (cluster) TSS_4040 (cluster) glgCp2 glgCp2 glgCp1 glgCp1 TSS_4039 TSS_4039 TSS_4038 TSS_4038 TSS_4037 TSS_4037 TSS_4036 TSS_4036 TSS_4035 TSS_4035 TSS_4034 TSS_4034 glgAp glgAp

Gene      
Name: glgB    Texpresso search in the literature
Synonym(s): ECK3418, EG10378, b3432
Genome position(nucleotides): 3571316 <-- 3573502 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.27
External database links:  
ASAP:
ABE-0011209
CGSC:
709
ECHOBASE:
EB0373
ECOLIHUB:
glgB
MIM:
232500
MIM:
263570
OU-MICROARRAY:
b3432
STRING:
511145.b3432
COLOMBOS: glgB


Product      
Name: 1,4-α-glucan branching enzyme
Synonym(s): GlgB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 84.337
Isoelectric point: 6.338
Motif(s):
 
Type Positions Sequence
125 -> 207 LGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFIPGAHNGQLYKYEMIDANGNLRLKSDPYA
273 -> 344 VPYAKWMGFTHLELLPINEHPFDGSWGYQPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTD
628 -> 725 WLVVDDKERSVLIFVRRDKEGNEIIVASNFTPVPRHDYRFGINQPGKWREILNTDSMHYHGSNAGNGGTVHSDEIASHGRQHSLSLTLPPLATIWLVR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.9 - cytoplasmic polysaccharides
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0102752 - 1,4-alpha-glucan branching enzyme activity (using a glucosylated glycogenin as primer for glycogen synthesis)
GO:0003824 - catalytic activity
GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0043169 - cation binding
GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0003844 - 1,4-alpha-glucan branching enzyme activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0005977 - glycogen metabolic process
GO:0005978 - glycogen biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Abad MC., et al., 2002
[2] Park JT., et al., 2011
External database links:  
CAZY:
CBM48
CAZY:
GH13
ECOCYC:
GLYCOGEN-BRANCH-MONOMER
ECOLIWIKI:
b3432
INTERPRO:
IPR006407
INTERPRO:
IPR006048
INTERPRO:
IPR006047
INTERPRO:
IPR004193
INTERPRO:
IPR014756
INTERPRO:
IPR037439
INTERPRO:
IPR013780
INTERPRO:
IPR013783
INTERPRO:
IPR017853
MODBASE:
P07762
PANTHER:
PTHR43651
PDB:
4LQ1
PDB:
4LPC
PDB:
1M7X
PDB:
1GTY
PDB:
5E6Y
PDB:
5E6Z
PDB:
5E70
PFAM:
PF02922
PFAM:
PF02806
PFAM:
PF00128
PRIDE:
P07762
REFSEQ:
NP_417890
SMART:
SM00642
SMR:
P07762
UNIPROT:
P07762


Operon      
Name: glgBXCAP         
Operon arrangement:
Transcription unit        Promoter
glgAP
glgCAP
glgCAP
glgCAP
glgBXCAP


Transcriptional Regulation      
Display Regulation             
Activated by: PhoP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4034 3568396 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4035 3568634 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4036 3568661 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4037 3568712 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4038 3568714 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4039 3569225 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4040 (cluster) 3569457 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4041 3570215 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4042 3570251 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4043 3570750 reverse nd [RS-EPT-CBR] [3]
  promoter glgXp3 3571419 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_4044 3571888 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4045 3572075 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4046 3572170 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4047 3572429 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4048 3572468 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4049 3572510 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Abad MC., Binderup K., Preiss J., Geiger JH., 2002, Crystallization and preliminary X-ray diffraction studies of Escherichia coli branching enzyme., Acta Crystallogr D Biol Crystallogr 58(Pt 2):359-61

 [2] Park JT., Shim JH., Tran PL., Hong IH., Yong HU., Oktavina EF., Nguyen HD., Kim JW., Lee TS., Park SH., Boos W., Park KH., 2011, Role of maltose enzymes in glycogen synthesis by Escherichia coli., J Bacteriol 193(10):2517-26

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB