RegulonDB RegulonDB 10.9: Gene Form
   

glgX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glgB glgX glgC yhgO yhgP PhoP ppGpp ppGpp glgBp glgBp TSS_4049 TSS_4049 TSS_4048 TSS_4048 TSS_4047 TSS_4047 TSS_4046 TSS_4046 TSS_4045 TSS_4045 TSS_4044 TSS_4044 glgXp3 glgXp3 TSS_4043 TSS_4043 TSS_4042 TSS_4042 TSS_4041 TSS_4041 glgCp3 glgCp3 TSS_4040 (cluster) TSS_4040 (cluster) glgCp2 glgCp2 glgCp1 glgCp1 TSS_4039 TSS_4039 TSS_4038 TSS_4038 TSS_4037 TSS_4037 TSS_4036 TSS_4036 TSS_4035 TSS_4035 TSS_4034 TSS_4034 glgAp glgAp

Gene      
Name: glgX    Texpresso search in the literature
Synonym(s): ECK3417, EG10381, b3431
Genome position(nucleotides): 3569346 <-- 3571319 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.36
External database links:  
ASAP:
ABE-0011206
ECHOBASE:
EB0376
ECOLIHUB:
glgX
OU-MICROARRAY:
b3431
STRING:
511145.b3431
COLOMBOS: glgX


Product      
Name: limit dextrin α-1,6-glucohydrolase
Synonym(s): GlgX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 73.577
Isoelectric point: 6.008
Motif(s):
 
Type Positions Sequence
11 -> 97 PLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGLRYGYRVHGPWQPAEGHRFNPAKLLIDPCA
571 -> 655 EEGDGNVRWLNRYAQPLSTDEWQNGPKQLQILLSDRFLIAINATLEVTEIVLPAGEWHAIPPFAGEDNPVITAVWQGPAHGLCVF
185 -> 269 INYLKQLGITALELLPVAQFASEPRLQRMGLSNYWGYNPVAMFALHPAYACSPETALDEFRDAIKALHKAGIEVILDIVLNHSAE
288 -> 288 Y

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0004133 - glycogen debranching enzyme activity
GO:0004135 - amylo-alpha-1,6-glucosidase activity
biological_process GO:0008152 - metabolic process
GO:0005975 - carbohydrate metabolic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0005977 - glycogen metabolic process
GO:0005980 - glycogen catabolic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
CBM48
CAZY:
GH13
ECOCYC:
EG10381-MONOMER
ECOLIWIKI:
b3431
INTERPRO:
IPR013783
INTERPRO:
IPR040784
INTERPRO:
IPR022844
INTERPRO:
IPR017853
INTERPRO:
IPR014756
INTERPRO:
IPR004193
INTERPRO:
IPR006047
INTERPRO:
IPR011837
INTERPRO:
IPR013780
MODBASE:
P15067
PDB:
2WSK
PFAM:
PF02922
PFAM:
PF00128
PFAM:
PF18390
PRIDE:
P15067
REFSEQ:
NP_417889
SMART:
SM00642
SMR:
P15067
UNIPROT:
P15067


Operon      
Name: glgBXCAP         
Operon arrangement:
Transcription unit        Promoter
glgAP
glgCAP
glgCAP
glgCAP
glgBXCAP


Transcriptional Regulation      
Display Regulation             
Activated by: PhoP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4034 3568396 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4035 3568634 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4036 3568661 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4037 3568712 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4038 3568714 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4039 3569225 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4040 (cluster) 3569457 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4041 3570215 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4042 3570251 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4043 3570750 reverse nd [RS-EPT-CBR] [1]
  promoter glgXp3 3571419 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_4044 3571888 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4045 3572075 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4046 3572170 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4047 3572429 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4048 3572468 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4049 3572510 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB