RegulonDB RegulonDB 10.8: Gene Form
   

glmS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glmS glmU pstS PhoB PhoB IHF GlmZ TSS_4289 TSS_4289 TSS_4288 TSS_4288 TSS_4287 TSS_4287 glmSp2 glmSp2 TSS_4286 TSS_4286 TSS_4285 TSS_4285 TSS_4284 TSS_4284 TSS_4283 TSS_4283 TSS_4282 TSS_4282 TSS_4281 TSS_4281 pstSp pstSp pstCp pstCp

Gene      
Name: glmS    Texpresso search in the literature
Synonym(s): ECK3722, EG10382, b3729
Genome position(nucleotides): 3911839 <-- 3913668 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.55
External database links:  
ASAP:
ABE-0012198
CGSC:
706
ECHOBASE:
EB0377
OU-MICROARRAY:
b3729
PortEco:
glmS
STRING:
511145.b3729
COLOMBOS: glmS


Product      
Name: L-glutamine—D-fructose-6-phosphate aminotransferase
Synonym(s): GlmS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 66.894
Isoelectric point: 5.741
Motif(s):
 
Type Positions Sequence
419 -> 420 KL
65 -> 182 HGGTGIAHTRWATHGEPSEVNAHPHVSEHIVVVHNGIIENHEPLREELKARGYTFVSETDTEVIAHLVNWELKQGGTLREAVLRAIPQLRGAYGTVIMDSRHPDTLLAARSGSPLVIG
462 -> 591 FSDKHHALFLGRGDQYPIALEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALI
2 -> 609 CGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGLAVVDAEGHMTRLRRLGKVQMLAQAAEEHPLHGGTGIAHTRWATHGEPSEVNAHPHVSEHIVVVHNGIIENHEPLREELKARGYTFVSETDTEVIAHLVNWELKQGGTLREAVLRAIPQLRGAYGTVIMDSRHPDTLLAARSGSPLVIGLGMGENFIASDQLALLPVTRRFIFLEEGDIAEITRRSVNIFDKTGAEVKRQDIESNLQYDAGDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNADELLSKVEHIQILACGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLSRLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIALEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPRNLAKSVTVE
458 -> 599 LAEDFSDKHHALFLGRGDQYPIALEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQP

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.1 - O antigen
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.12 - amino sugar conversions
  6 - cell structure --> 6.2 - murein
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0008483 - transaminase activity
GO:0004360 - glutamine-fructose-6-phosphate transaminase (isomerizing) activity
GO:0097367 - carbohydrate derivative binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006541 - glutamine metabolic process
GO:0006047 - UDP-N-acetylglucosamine metabolic process
GO:0006048 - UDP-N-acetylglucosamine biosynthetic process
GO:0006002 - fructose 6-phosphate metabolic process
GO:0006487 - protein N-linked glycosylation
GO:1901135 - carbohydrate derivative metabolic process
GO:1901137 - carbohydrate derivative biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9775N
ECOCYC:
L-GLN-FRUCT-6-P-AMINOTRANS-MONOMER
ECOLIWIKI:
b3729
INTERPRO:
IPR029055
INTERPRO:
IPR035466
INTERPRO:
IPR001347
INTERPRO:
IPR005855
INTERPRO:
IPR017932
INTERPRO:
IPR035490
MINT:
MINT-1238536
MODBASE:
P17169
PANTHER:
PTHR10937:SF0
PDB:
4AMV
PDB:
2VF5
PDB:
2VF4
PDB:
2J6H
PDB:
1XFG
PDB:
1XFF
PDB:
1MOS
PDB:
1MOR
PDB:
1MOQ
PDB:
1JXA
PDB:
3OOJ
PFAM:
PF01380
PRIDE:
P17169
PRODB:
PRO_000022781
PROSITE:
PS51464
PROSITE:
PS51278
REFSEQ:
NP_418185
SMR:
P17169
UNIPROT:
P17169


Operon      
Name: glmUS         
Operon arrangement:
Transcription unit        Promoter
glmUS
glmUS


Transcriptional Regulation      
Display Regulation             
Activated by: NagC
Repressed by: NagC


Regulation by small RNA    
  Display Regulation
small RNA glmY, glmZ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4281 3912376 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4282 3912783 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4283 3912803 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4284 3913003 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4285 3913355 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4286 3913684 reverse nd [RS-EPT-CBR] [1]
  promoter glmSp2 3913811 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_4287 3913867 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4288 3913870 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4289 3914025 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB