RegulonDB RegulonDB 10.8: Gene Form
   

glnG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: glnG    Texpresso search in the literature
Synonym(s): ECK3861, EG10385, b3868, glnT, ntrC
Genome position(nucleotides): 4053869 <-- 4055278 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.95
External database links:  
ASAP:
ABE-0012632
CGSC:
702
ECHOBASE:
EB0380
OU-MICROARRAY:
b3868
PortEco:
glnG
STRING:
511145.b3868
COLOMBOS: glnG


Product      
Name: DNA-binding transcriptional dual regulator NtrC
Synonym(s): GlnG, GlnT, NtrC, NtrC response regulator
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 52.255
Isoelectric point: 6.465
Motif(s):
 
Type Positions Sequence
5 -> 119 IVWVVDDDSSIRWVLERALAGAGLTCTTFENGAEVLEALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAI
231 -> 240 ADGGTLFLDE
168 -> 175 GESGTGKE
445 -> 464 KQEAARLLGWGRNTLTRKLK
142 -> 144 GEA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.2 - glutamine
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0008134 - transcription factor binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000156 - phosphorelay response regulator activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
GO:0006808 - regulation of nitrogen utilization
GO:0009399 - nitrogen fixation
Reference(s): [1] Lee J., et al., 2000
[2] Pahel G., et al., 1979
External database links:  
DIP:
DIP-9781N
ECOCYC:
PROTEIN-NRI
ECOLIWIKI:
b3868
INTERPRO:
IPR010114
INTERPRO:
IPR027417
INTERPRO:
IPR025944
INTERPRO:
IPR025943
INTERPRO:
IPR025662
INTERPRO:
IPR011006
INTERPRO:
IPR009057
INTERPRO:
IPR003593
INTERPRO:
IPR002197
INTERPRO:
IPR002078
INTERPRO:
IPR001789
MODBASE:
P0AFB8
PANTHER:
PTHR32071:SF45
PFAM:
PF02954
PFAM:
PF00072
PFAM:
PF00158
PRIDE:
P0AFB8
PRINTS:
PR01590
PRODB:
PRO_000022786
PROSITE:
PS00675
PROSITE:
PS50045
PROSITE:
PS00688
PROSITE:
PS50110
PROSITE:
PS00676
REFSEQ:
NP_418304
SMART:
SM00448
SMART:
SM00382
SMR:
P0AFB8
SWISSMODEL:
P0AFB8
UNIPROT:
P0AFB8


Operon      
Name: glnALG         
Operon arrangement:
Transcription unit        Promoter
glnLG
glnA
glnALG
glnA
glnALG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, NtrC, Fis
Repressed by: CRP, NtrC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4546 (cluster) 4053777 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4547 (cluster) 4053810 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]



RegulonDB