RegulonDB RegulonDB 10.8: Gene Form
   

glnL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glnA glnG glnL glnA3\' typA5\' NtrC anti-anti-terminator anti-terminator terminator TSS_4559 TSS_4559 TSS_4558 TSS_4558 TSS_4557 (cluster) TSS_4557 (cluster) TSS_4556 TSS_4556 TSS_4555 TSS_4555 TSS_4554 TSS_4554 TSS_4553 TSS_4553 TSS_4552 TSS_4552 TSS_4551 TSS_4551 TSS_4550 (cluster) TSS_4550 (cluster) TSS_4549 TSS_4549 TSS_4548 (cluster) TSS_4548 (cluster) glnLp glnLp

Gene      
Name: glnL    Texpresso search in the literature
Synonym(s): ECK3862, EG10387, b3869, glnR, ntrB
Genome position(nucleotides): 4055290 <-- 4056339 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.24
External database links:  
ASAP:
ABE-0012634
CGSC:
701
ECHOBASE:
EB0382
OU-MICROARRAY:
b3869
PortEco:
glnL
STRING:
511145.b3869
COLOMBOS: glnL


Product      
Name: sensory histidine kinase NtrB
Synonym(s): GlnL, GlnR, NtrB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 38.556
Isoelectric point: 5.385
Motif(s):
 
Type Positions Sequence
131 -> 186 RDLVRGLAHEIKNPLGGLRGAAQLLSKALPDPSLLEYTKVIIEQADRLRNLVDRLL
5 -> 78 TQPDAGQILNSLINSILLIDDNLAIHYANPAAQQLLAQSSRKLFGTPLPELLSYFSLNIELMQESLEAGQGFTD
11 -> 99 QILNSLINSILLIDDNLAIHYANPAAQQLLAQSSRKLFGTPLPELLSYFSLNIELMQESLEAGQGFTDNEVTLVIDGRSHILSVTAQRM
234 -> 347 DPDQIEQVLLNIVRNALQALGPEGGEIILRTRTAFQLTLHGERYRLAARIDVEDNGPGIPPHLQDTLFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFTSWPGHTEFSVYLPI
136 -> 349 GLAHEIKNPLGGLRGAAQLLSKALPDPSLLEYTKVIIEQADRLRNLVDRLLGPQLPGTRVTESIHKVAERVVTLVSMELPDNVRLIRDYDPSLPELAHDPDQIEQVLLNIVRNALQALGPEGGEIILRTRTAFQLTLHGERYRLAARIDVEDNGPGIPPHLQDTLFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFTSWPGHTEFSVYLPIRK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.2 - glutamine
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005886 - plasma membrane
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0004721 - phosphoprotein phosphatase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0006470 - protein dephosphorylation
GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0046777 - protein autophosphorylation
GO:0051171 - regulation of nitrogen compound metabolic process
GO:0009399 - nitrogen fixation
GO:0018106 - peptidyl-histidine phosphorylation
GO:0023014 - signal transduction by protein phosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Jiang P., et al., 1999
[2] Kramer G., et al., 1999
[3] Ninfa EG., et al., 1993
External database links:  
DIP:
DIP-9784N
ECOCYC:
PROTEIN-NRII
ECOLIWIKI:
b3869
INTERPRO:
IPR003661
INTERPRO:
IPR036890
INTERPRO:
IPR036097
INTERPRO:
IPR035965
INTERPRO:
IPR013767
INTERPRO:
IPR005467
INTERPRO:
IPR004358
INTERPRO:
IPR003594
INTERPRO:
IPR000014
MODBASE:
P0AFB5
PDB:
1R62
PFAM:
PF02518
PFAM:
PF00512
PFAM:
PF00989
PRIDE:
P0AFB5
PRINTS:
PR00344
PRODB:
PRO_000022789
PROSITE:
PS50109
PROSITE:
PS50112
REFSEQ:
NP_418305
SMART:
SM00091
SMART:
SM00388
SMART:
SM00387
SMR:
P0AFB5
SWISSMODEL:
P0AFB5
UNIPROT:
P0AFB5


Operon      
Name: glnALG         
Operon arrangement:
Transcription unit        Promoter
glnLG
glnA
glnALG
glnA
glnALG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, NtrC, Fis
Repressed by: CRP, NtrC


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4548 (cluster) 4056602 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_4549 4056615 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4550 (cluster) 4056622 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_4551 4057070 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4552 4057076 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4553 4057079 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4554 4057208 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4555 4057214 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4556 4057685 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4557 (cluster) 4057694 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_4558 4057741 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4559 4057761 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jiang P., Ninfa AJ., 1999, Regulation of autophosphorylation of Escherichia coli nitrogen regulator II by the PII signal transduction protein., J Bacteriol 181(6):1906-11

 [2] Kramer G., Weiss V., 1999, Functional dissection of the transmitter module of the histidine kinase NtrB in Escherichia coli., Proc Natl Acad Sci U S A 96(2):604-9

 [3] Ninfa EG., Atkinson MR., Kamberov ES., Ninfa AJ., 1993, Mechanism of autophosphorylation of Escherichia coli nitrogen regulator II (NRII or NtrB): trans-phosphorylation between subunits., J Bacteriol 175(21):7024-32

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB