RegulonDB RegulonDB 11.0: Gene Form

gltD gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

gltB gltD gltF TSS_3549 TSS_3549 TSS_3548 TSS_3548 TSS_3547 TSS_3547 TSS_3546 (cluster) TSS_3546 (cluster) TSS_3545 TSS_3545 TSS_3544 TSS_3544 TSS_3543 (cluster) TSS_3543 (cluster) TSS_3542 (cluster) TSS_3542 (cluster) TSS_3541 TSS_3541 TSS_3540 TSS_3540 TSS_3539 TSS_3539 TSS_3538 TSS_3538 TSS_3537 TSS_3537 TSS_3536 TSS_3536 TSS_3535 TSS_3535 TSS_3534 TSS_3534

Name: gltD    Texpresso search in the literature
Synonym(s): ECK3203, EG10404, aspB, b3213, ossB, psiQ
Genome position(nucleotides): 3359198 --> 3360616
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: glutamate synthase subunit GltD
Synonym(s): AspB, GltD, OssB, PsiQ, glutamate synthase, small subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 52.015
Isoelectric point: 5.436
Type Positions Sequence Comment
38 -> 69 GQAKAQADRCLSCGNPYCEWKCPVHNYIPNWL UniProt: 4Fe-4S ferredoxin-type.
123 -> 123 E UniProt: In Ref. 1; AAA23905..


Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> - glutamate
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0009342 - glutamate synthase complex (NADPH)
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0004355 - glutamate synthase (NADPH) activity
GO:0004354 - glutamate dehydrogenase (NADP+) activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0006537 - glutamate biosynthetic process
GO:0006807 - nitrogen compound metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0019676 - ammonia assimilation cycle
GO:0097054 - L-glutamate biosynthetic process
External database links:  

Name: gltBDF         
Operon arrangement:
Transcription unit        Promoter

Transcriptional Regulation      
Display Regulation             
Activated by: HdfR, IHF, Lrp, GadE, AdiY
Repressed by: Nac, CRP, FNR, Fur, ArgR

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3534 3356105 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3535 3356236 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3536 3356239 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3537 3356669 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3538 3356672 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3539 3356806 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3540 3357175 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3541 3357512 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3542 (cluster) 3357958 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3543 (cluster) 3357974 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3544 3357991 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3545 3359147 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3546 (cluster) 3359164 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3547 3359356 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3548 3359426 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3549 3359434 forward nd [RS-EPT-CBR] [1]


 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates


 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.
