RegulonDB RegulonDB 10.9: Gene Form
   

gpt gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pepD frsA gpt CsgD terminator anti-terminator anti-anti-terminator TSS_455 TSS_455 frsAp frsAp TSS_453 TSS_453 gptp gptp TSS_452 TSS_452 pepDp1 pepDp1 TSS_450 TSS_450 pepDp2 pepDp2 TSS_448 (cluster) TSS_448 (cluster) TSS_447 TSS_447 pepDp3 pepDp3

Gene      
Name: gpt    Texpresso search in the literature
Synonym(s): ECK0239, EG10414, b0238, glyD, gpp, gxu
Genome position(nucleotides): 255977 --> 256435 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.85
External database links:  
ASAP:
ABE-0000814
ECHOBASE:
EB0409
ECOLIHUB:
gpt
NCBI-GENE:
944817
OU-MICROARRAY:
b0238
STRING:
511145.b0238
COLOMBOS: gpt


Product      
Name: xanthine-guanine phsophoribosyltransferase
Synonym(s): GlyD, Gpp, Gpt, Gxu
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 16.971
Isoelectric point: 5.626
Motif(s):
 
Type Positions Sequence
59 -> 59 C
122 -> 122 V
12 -> 143 LQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGV
92 -> 96 DTGGT
134 -> 135 WI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0032991 - protein-containing complex
molecular_function GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0000310 - xanthine phosphoribosyltransferase activity
GO:0004422 - hypoxanthine phosphoribosyltransferase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
GO:0097216 - guanosine tetraphosphate binding
biological_process GO:0009116 - nucleoside metabolic process
GO:0006166 - purine ribonucleoside salvage
GO:0032263 - GMP salvage
GO:0032264 - IMP salvage
GO:0032265 - XMP salvage
GO:0051289 - protein homotetramerization
External database links:  
ECOCYC:
GPT-MONOMER
ECOLIWIKI:
b0238
INTERPRO:
IPR023747
INTERPRO:
IPR000836
INTERPRO:
IPR029057
MODBASE:
P0A9M5
PANTHER:
PTHR39563
PDB:
4JLS
PDB:
4JIT
PDB:
1NUL
PDB:
1A98
PDB:
1A97
PDB:
1A96
PDB:
1A95
PFAM:
PF00156
PRIDE:
P0A9M5
PRODB:
PRO_000022834
PROSITE:
PS00103
REFSEQ:
NP_414773
SMR:
P0A9M5
UNIPROT:
P0A9M5


Operon      
Name: gpt         
Operon arrangement:
Transcription unit        Promoter
gpt


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_447 255756 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_448 (cluster) 255770 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_450 255807 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_452 255816 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_453 255918 forward nd [RS-EPT-CBR] [1]
  promoter TSS_455 256509 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB