RegulonDB RegulonDB 10.9: Gene Form
   

greA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dacB greA yhbY anti-anti-terminator anti-terminator terminator terminator TSS_3490 TSS_3490 greAp1 greAp1 dacBp5 dacBp5 greAp2 greAp2 TSS_3489 TSS_3489 TSS_3488 TSS_3488

Gene      
Name: greA    Texpresso search in the literature
Synonym(s): ECK3170, EG10415, b3181
Genome position(nucleotides): 3328239 <-- 3328715 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.43
External database links:  
ASAP:
ABE-0010454
CGSC:
33506
ECHOBASE:
EB0410
ECOLIHUB:
greA
OU-MICROARRAY:
b3181
STRING:
511145.b3181
COLOMBOS: greA


Product      
Name: transcription elongation factor GreA
Synonym(s): GreA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.641
Isoelectric point: 4.431
Motif(s):
 
Type Positions Sequence
4 -> 74 IPMTLRGAEKLREELDFLKSVRRPEIIAAIAEAREHGDLKENAEYHAAREQQGFCEGRIKDIEAKLSNAQV
83 -> 157 NGRVIFGATVTVLNLDSDEEQTYRIVGDDEADFKQNLISVNSPIARGLIGKEEDDVVVIKTPGGEVEFEVIKVEY

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0070063 - RNA polymerase binding
GO:0001108 - bacterial-type RNA polymerase holo enzyme binding
biological_process GO:0032784 - regulation of DNA-templated transcription, elongation
GO:0006354 - DNA-templated transcription, elongation
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IE] Inferred from experiment
Reference(s): [1] Altmann CR., et al., 1994
[2] Borukhov S., et al., 1992
[3] Darst SA., et al., 1994
[4] Orlova M., et al., 1995
[5] Potrykus K., et al., 2010
[6] Sparkowski J., et al., 1991
[7] Trautinger BW., et al., 2002
External database links:  
DIP:
DIP-35800N
ECOCYC:
EG10415-MONOMER
ECOLIWIKI:
b3181
INTERPRO:
IPR036805
INTERPRO:
IPR028624
INTERPRO:
IPR023459
INTERPRO:
IPR036953
INTERPRO:
IPR001437
INTERPRO:
IPR006359
INTERPRO:
IPR018151
INTERPRO:
IPR022691
MODBASE:
P0A6W5
PANTHER:
PTHR30437
PDB:
1GRJ
PFAM:
PF01272
PFAM:
PF03449
PRIDE:
P0A6W5
PRODB:
PRO_000022836
PROSITE:
PS00830
PROSITE:
PS00829
REFSEQ:
NP_417648
SMR:
P0A6W5
UNIPROT:
P0A6W5


Operon      
Name: greA         
Operon arrangement:
Transcription unit        Promoter
greA
greA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3488 3328043 forward nd [RS-EPT-CBR] [8]
  promoter TSS_3489 3328852 reverse nd [RS-EPT-CBR] [8]
  promoter dacBp5 3328857 forward Similarity to the consensus
Read more >
[ICWHO] [9]
  promoter TSS_3490 3328936 forward nd [RS-EPT-CBR] [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Altmann CR., Solow-Cordero DE., Chamberlin MJ., 1994, RNA cleavage and chain elongation by Escherichia coli DNA-dependent RNA polymerase in a binary enzyme.RNA complex., Proc Natl Acad Sci U S A 91(9):3784-8

 [2] Borukhov S., Polyakov A., Nikiforov V., Goldfarb A., 1992, GreA protein: a transcription elongation factor from Escherichia coli., Proc Natl Acad Sci U S A 89(19):8899-902

 [3] Darst SA., Stebbins CE., Borukhov S., Orlova M., Feng G., Landick R., Goldfarb A., 1994, Crystallization of GreA, a transcript cleavage factor from Escherichia coli., J Mol Biol 242(4):582-5

 [4] Orlova M., Newlands J., Das A., Goldfarb A., Borukhov S., 1995, Intrinsic transcript cleavage activity of RNA polymerase., Proc Natl Acad Sci U S A 92(10):4596-600

 [5] Potrykus K., Murphy H., Chen X., Epstein JA., Cashel M., 2010, Imprecise transcription termination within Escherichia coli greA leader gives rise to an array of short transcripts, GraL., Nucleic Acids Res 38(5):1636-51

 [6] Sparkowski J., Das A., 1991, Location of a new gene, greA, on the Escherichia coli chromosome., J Bacteriol 173(17):5256-7

 [7] Trautinger BW., Lloyd RG., 2002, Modulation of DNA repair by mutations flanking the DNA channel through RNA polymerase., EMBO J 21(24):6944-53

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [9] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB