RegulonDB RegulonDB 10.10: Gene Form
   

gshB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gshB rsmE yqgE terminator anti-terminator TSS_3277 (cluster) TSS_3277 (cluster) TSS_3276 (cluster) TSS_3276 (cluster) yqgEp3 yqgEp3 TSS_3275 (cluster) TSS_3275 (cluster) TSS_3274 TSS_3274 TSS_3273 TSS_3273 TSS_3272 TSS_3272 TSS_3271 TSS_3271

Gene      
Name: gshB    Texpresso search in the literature
Synonym(s): ECK2942, EG10419, b2947, gsh-II
Genome position(nucleotides): 3091878 --> 3092828 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.42
External database links:  
ASAP:
ABE-0009667
CGSC:
33370
ECHOBASE:
EB0414
ECOLIHUB:
gshB
OU-MICROARRAY:
b2947
STRING:
511145.b2947
COLOMBOS: gshB


Product      
Name: glutathione synthetase
Synonym(s): GshB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.561
Isoelectric point: 4.851
Motif(s):
 
Type Positions Sequence
151 -> 207 WEKHSDIILKPLDGMGGASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAIKDG
222 -> 222 C
227 -> 227 P
122 -> 122 C
195 -> 195 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.10 - glutathione
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016874 - ligase activity
GO:0016879 - ligase activity, forming carbon-nitrogen bonds
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004363 - glutathione synthase activity
GO:0000287 - magnesium ion binding
biological_process GO:0006750 - glutathione biosynthetic process
External database links:  
DIP:
DIP-9840N
ECOCYC:
GLUTATHIONE-SYN-MONOMER
ECOLIWIKI:
b2947
INTERPRO:
IPR004215
INTERPRO:
IPR016185
INTERPRO:
IPR004218
INTERPRO:
IPR006284
INTERPRO:
IPR011761
INTERPRO:
IPR013815
MODBASE:
P04425
PANTHER:
PTHR21621:SF4
PDB:
1GLV
PDB:
2GLT
PDB:
1GSH
PDB:
1GSA
PFAM:
PF02955
PFAM:
PF02951
PRIDE:
P04425
PROSITE:
PS50975
REFSEQ:
NP_417422
SMR:
P04425
UNIPROT:
P04425


Operon      
Name: rsmE-gshB         
Operon arrangement:
Transcription unit        Promoter
rsmE-gshB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3271 3091787 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3272 3091809 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3273 3092076 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3274 3092824 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3275 (cluster) 3092826 forward nd [RS-EPT-CBR] [1]
  promoter yqgEp3 3092884 forward nd [ICWHO] [2]
  promoter TSS_3276 (cluster) 3092900 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3277 (cluster) 3092907 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB